19,441 Free Images of 1st

cc-zerocc-pd-markfiles uploaded by daderotauthor died more than 100 years ago public domain imagesvehiclewateraircraftmilitaryunited states navy explosive ordnance disposalnavy
US Navy 090219-N-9552I-030 Naval Aircrewmen 1st Class Troy Rudisill and David Williams conduct pre-flight checks in the cockpit of a Gulfstream C-20A-G III
military aviators in cockpitsgulfstream iii
US Navy 091029-N-6220J-016 Aviation Boatswain's Mate (Fuels) 1st Class Ulric Carter reviews a young girl's reading homework at the Finnigan Park Boys and Girls Club
architecturefuel
US Navy 091104-N-0807W-320 Engineman 1st Class Donandrew R. Paredes, assigned to Assault Craft Unit (ACU) 5 embarked aboard the amphibious dock landing ship USS Harpers Ferry (LSD 49)
landing craftair cushion
US Navy 110218-N-8607R-127 Marines assigned to the Force Reconnaissance Platoon of the 31st Marine Expeditionary Unit (31st MEU) fast rope
aircraftaviation
US Navy 101111-N-3154P-236 Naval Air Crewman 1st Class Joseph Ward, assigned to Helicopter Sea Combat Squadron (HSC) 22, examines the tail rotor of
militaryvehicle
US Navy 070808-N-3093M-001 Navy Diver 1st Class Josuha Harsh Mobile Diving and Salvage Unit (MDSU) 2 from Naval Amphibious Base Little Creek, Va., gives the okay sign after having his MK-21 diving helmet remove
i-35w mississippi river bridge collapse recoveryunited states navy divers
US Navy 080604-N-8848T-071 Rear Adm. Jon W. Bayless, right, the commander of Navy Region Midwest, reenlists Navy Counselor 1st Class Sean Nagle at U.S. Cellular Field
reenlistmentjr
US Navy 080617-N-3857R-019 Special warfare combatant-craft (SWCC) crewmen assigned to Special Boat Team 22 traverse the waterways of the Stennis Space Center
vehiclewater
US Navy 040920-N-3019M-006 Boatswain's Mate 1st Class Jesse Rodriguez cooks hamburgers, hot dogs and chicken for family members
grillfood
US Navy 041016-N-9693M-004 U.S. Naval Academy Midshipman 1st Class Kyle Eckel is tackled by Notre Dame line backer Brandon Hoyte at Giants Stadium in Rutherford, N.J
new jerseysport
US Navy 050908-N-6477M-271 Hull Technician 1st Class Chance D. Barker casts off a line from the pier as the Nimitz-class aircraft carrier USS Abraham Lincoln (CVN 72) prepares for departure from Naval Station Everett, Wash
waterboat
US Navy 040329-N-3228G-003 Master-at-Arms Seaman Ray Cowan and Master-at-Arms 1st Class Vicki Guist, both assigned to Naval Station Pearl Harbor Security, patrol the West Loch area of Pearl Harbor
people at pearl harbormaster-at-arms
US Navy 070202-N-8110K-047 Information Systems Technician 1st Class Tanya Whitner and fellow Sailors assigned to guided missile cruiser USS Mahan (DDG 72) serve lunch to homeless veterans at the New England Shelter for Homeless
veterans of the united statesaboard uss mahan (ddg-72)
US Navy 060606-N-9851B-015 1st Sgt. Louis Goh and Personnel Specialist 2nd Class Tristan Delatorre, members of a combined U.S. and RSN visit, board, search and seizure (VBSS) team, compare equipment on the deck of amphibious do
personnel specialist (united states navy)aboard uss tortuga (lsd-46)
US Navy 060503-N-8269F-002 Legalman 1st Class Malinda Schreffler assigned to Commander Carrier Strike group Two (CCSG-2) work alongside fellow shipmates assigned to the amphibious transport dock ship USS Shreveport (LPD 12)
united states navy images from port evergladesuss shreveport (lpd-12)
US Navy 051202-N-9851B-002 U.S. Navy Mineman 1st Class Kieth Pierson, assigned to Explosive Ordnance Disposal Mobile Unit Five (EODMU-5), Detachment Japan, directs the actions of a Remote Ordnance Neutralization System
minemanarmy
US Navy 110423-N-GL340-029 Logistics Specialist Seaman Immanuel Carter and Logistics Specialist 1st Class Kristopher Forest run to clear an SH-60H
logistic specialistnavy
Bottle, attributed to southern Syria, 200-300 AD, free-blown glass, waisted neck, rolled and flared rim - Huntington Museum of Art - DSC04833
3rd-century glassware in the united statesself-published work
Wroclaw1maja1982-063
monochromewhite
US Navy 090424-N-9928E-067 Gunner's Mate 1st Class Eddieesther Trinidad, left, from San Diego, Calif., helps Gunner's Mate 3rd Class Casey Gil, from Newaygo, Mich., load a .50-caliber machine gun
browning m2 in united states navy servicegunner's mate
US Navy 070605-N-4515N-069 Special Warfare Boat Operator 1st Class Nicholas Powell navigates a Mark Five Special Operations Craft while Chief Special Warfare Boat Operator Dwayne Van Tassel explains some of the controls to Secr
mark v special operations craftvirginia
US Navy 070702-N-5555T-009 U.S. Army Soldiers from 2nd Platoon, Bravo Company, 1st Battalion, 30th Infantry Regiment, receive a briefing about a high-value target in the Arab Jabour region of Iraq
30th infantry regiment (united states)males with m4 carbine
Archway tiles, men, detail - Hearst Castle - DSC06339
self-published workcc-pd-mark
Thos Perkins of Salem in the Canton River, January 1st 1840, by Sunqua, 1840 AD, oil on canvas - Peabody Essex Museum - Salem, MA - DSC05297
vehiclewater
Bixie (chimera), attributed to Chu culture, Hunan or Hubei province, China, Western Han dynasty, 2nd-1st century BC, cast iron with silver inlay - Portland Art Museum - Portland, Oregon - DSC08552
self-published workcc-pd-mark
Lamp in the shape of a bear, China, Eastern Han dynasty, 1st-3rd century AD, ceramic, green glaze - Tokyo National Museum - Tokyo, Japan - DSC08482
self-published workcc-pd-mark
Oil lamp, Hebei province, China, Eastern Han dynasty, 1st-2nd century AD, earthenware, pigments - Portland Art Museum - Portland, Oregon - DSC08604
self-published workinterior
Mirror with the Judgement of Paris, Etruscan, 1st half of the 3rd century BC, bronze, ZA 64 - Martin von Wagner Museum - Würzburg, Germany - DSC05727
self-published workcc-pd-mark
US Navy 050607-N-6832D-040 Commander U.S. 7th Fleet, Vice Adm. Jonathan W. Greenert and Commander 1st Division, Deployable Joint Force Headquarters, Maj. Gen. Mark Kelly greet the local media
aboard uss blue ridge (lcc-19)talisman sabre 2005
U.S. Navy Boatswain's Mate 1st Class Eddie Montalvo, left, assigned to Commander, Task Force (CTF) 56, reassembles an M4 carbine during weapons training at Naval Support Activity Bahrain in Manama, Bahrain 140212-N-OU681-214
militaryarmy
U.S. Navy Special Warfare Operator 1st Class (SEAL) David Goggins, right, assigned to Naval Special Warfare Center, embraces Cmdr. Keith Davids, commanding officer of SEAL Team One, as they cross the finish line 081011-N-BV344-004
ironman world championshipsport
US Navy 060606-N-4205W-004 Chief Navy Diver Matthew Stevens and Navy Diver 1st Class Kevin Parsons stage handle Master Sgt. David Ling from the Republic of Singapore Navy (RSN) prior to conducting a dive
cooperation afloat readiness and training 2006united states navy divers
US Navy 060812-N-3714J-095 Navy Musician 1st Class Brian Grondell of Dedham, Mass., a member of U.S. Navy Showband embarked with the Medical Treatment Facility aboard the Military Sealift Command (MSC) hospital ship USNS Mercy
celebritiespeople
US Navy 070522-N-6247M-007 Master at Arms 3rd Class David Barnett, from Belgrade, Mt. (Driver), and Master at Arms 1st Class Daniel Bellwood, from Methuen, Mass. (Passenger), drive a golf cart through traffic cones while wearin
drunk driving traffic cone
US Navy 070815-N-0000X-001 Hospital Corpsman 1st Class Jennifer Kraus de-worms an infant Afghan boy
children of afghanistanboys of afghanistan
US Navy 071112-N-6676S-011 Aviation Structural Mechanic (Equipment) 1st Class Emmanuel G. Leyaog, a recruiter from Naval Recruit Depot, Richmond, Va., walks the POW-MIA flag draped over a wheelchair during the 2007 Tidewater Ve
sidewalkvirginia
US Navy 070722-N-5928K-003 Aircrew Survival Equipmentman 1st Class Paul-Brian Raghoo assists British Royal Air Force Air Marshall, Sir Graham Anthony Miller, with his helmet prior to launching from the flight deck
aboard uss enterprise (cvn-65)people
US Navy 070918-N-4649C-110 Gunner's Mate 1st Class Matt Kelly loads ordnance onto an elevator aboard Arleigh-Burke class guided-missile destroyer USS Lassen (DDG 82) during an ammunition onload
artillery ammunitiongunner's mate
US Navy 080719-N-9623R-001 Equipment Operator 1st Class Bryan Anselmi, assigned to Naval Mobile Construction Battalion (NMCB) 17, guides as Equipment Operator 2nd Class Lucinda Hale operates a compaction roller to level a weapo
equipment operator (united states navy)naval mobile construction battalion 17
US Navy 090226-N-1688B-061 hief Engineman Edward Young, Equipment Operator 1st Class Thomas Bonacci and Hull Technician 2nd Class Thomas Wojcinski train Ghanaian and Mozambiquen sailors to fix small boat out board engines
united states navy in sekondi-takoradigroup
US Navy 090304-N-4205W-032 Students from the Western Hemisphere Institute for Security Cooperation prepare to be extracted
naval small craft instruction and technical training school since 1st october 1998males with m16 rifle
US Navy 110217-N-8607R-024 Marines assigned to the Force Reconnaissance Platoon of the 31st Marine Expeditionary Unit (31st MEU)
militaryaircraft
US Navy 090328-N-5242D-337 Explosive Ordnance Disposal Technician 1st Class Jeremy Starks helps Lt.j.g. Scott Bryant suit up before diving into Africa's Lake Victoria
united states navy explosive ordnance disposalexplosive ordnance disposal mobile unit 2
US Navy 080211-N-0773H-061 Musicians 1st class Jason W. Niehoff, left, Curt R. Duer and John J. Martinich, all members of the percussion section, perform on stage during a concert presented at Great Mills High School
marylanddrum
US Navy 090611-N-5242D-171 Machinery Repairman 2nd Class James Porter and Damage Controlman 1st Class James Harry train Djiboutian sailors in hose-handling techniques on the flight deck of the guided-missile destroyer USS Arlei
fire hosepeople
US Navy 090506-N-9928E-025 Aviation Boatswain's Mate (Handling) 1st Class James Webb, from Yokosuka, Japan, directs a C-2A Greyhound from the
vehiclehandler
US Navy 090508-N-5366K-007 FRISCO, Texas (May 8, 2009) Aviation Survival Equipmentman 1st Class Victor Maldonado, assigned to the U.S. Navy Parachute Team the Leap Frogs, shows Frisco Rough Riders fans how to pack his parachute
celebritiespeople
US Navy 100326-N-7939W-109 Machinist's Mate 1st Class Jay Hinton mans the rails with his son and other Nimitz Sailors on the flight deck of the aircraft carrier USS Nimitz (CVN 68) as the ship transits into its homeport at Nava
manning the rail on uss nimitz (cvn-68)people
US Navy 100423-N-4267W-083 Dr. Clifford L. Stanley, Under Secretary of Defense for Personnel and Readiness, awards the Bronze Star medal to Explosive Ordnance Disposal Technician 1st Class Dewayne Cheatham
united states navy images from virginia beachvirginia
US Navy 051119-N-9851B-009 U.S. Navy Aviation Ordnanceman 1st Class Brandon Smith, left, and Chief Sonar Technician Isaac Callicrate return to their boat after diving into Tokyo Bay
aviation ordnancemanwater
US Navy 051119-N-9851B-011 U.S. Navy Gunner's Mate 1st Class Benjamin Rudolph supports Chief Sonar Technician Isaac Callicrate, as they move to a new position in Tokyo Bay
gunner's matewater
US Navy 100706-N-0995C-078 Capt. Richard L. Clemmons, right, commodore of Task Group 73.1, shakes hands with Col. Tiong Kian Sim, commander of the Republic of Singapore's 1st Flotilla
cooperation afloat readiness and training 2010jr
US Navy 100727-N-5085J-005 Hull Maintenance Technician 1st Class Michael Kubicki shows his sister Melissa a self-contained breathing apparatus aboard USS Dwight D. Eisenhower (CVN 69) during Tiger Cruise 2010
self-contained breathing apparatuspeople
US Navy 090629-N-1722M-162 Musician 1st Class Danny McGowan, assigned to the U.S. 7th Fleet rock band, Orient Express, sings with Malaysian Army Cpl. Nor Azlan during a performance with the Malaysian Armed Forces KOMBO D' Tiger
terengganucowbell
US Navy 090704-N-1062H-073 Air Traffic Controller 1st Class Luke Wray plays with Cruiser, a dog at the Dogs Refuge Home, during a community service project
white doganimals
Portrait of an unknown woman, Peter Lely, circa 1670
female portraits by peter lelybaroque painting
William Pitt, 1st Earl of Chatham (copy after an original of 1772), Richard Brompton, between 1772 and 1868
william pitt, 1st earl of chathamearl of chatham (after brompton)
Metropolitan Railway 1st - 3rd Composite Coach No.368
vehiclecar
One-handled amphora, late 1st century AD, 1995.10.5 - Cesnola Collection, Harvard Semitic Museum - Cambridge, MA - DSC06267
brownwood
Youth with dog, known as Endymion, S 36, Roman, 1st century AD, marble, detail, after a Greek work from the late 4th century BC - Musei Capitolini - Rome, Italy - DSC06136
self-published workcc-pd-mark
Metropolitan Railway 1st Class Jubilee Coach
vehiclecar
Urn lid with reclining male figure, chest with battle against the centaurs, Guarnacci 621 workshop, first quarter of the 1st century BC, inv. 13890 - Museo Gregoriano Etrusco - Vatican Museums - DSC01102
self-published workcc-pd-mark
Pan statuette, S 199, Roman, 1st century AD, marble, from a Greek prototype of the 4th century BC - Musei Capitolini - Rome, Italy - DSC06171
self-published workcc-pd-mark
Marquess of Buckingham (George Nugent-Temple-Grenville) - Wedgwood Museum - Barlaston, Stoke-on-Trent, England - DSC09709
self-published workcc-pd-mark
Defense.gov News Photo 100627-N-6903G-298 - U.S. Army 1st Lt. J.D. Caddell left from Bravo Company 5th Battalion 20th Infantry Regiment 3rd Stryker Brigade Combat Team 2nd Infantry
2nd infantry division (united states)army
Defense.gov News Photo 110411-N-HI707-410 - U.S. Navy Petty Officer 1st Class Eric Bel 2nd from left instructs a member of the Nigerian Naval Police on firefighting methods during a damage
police officerpeople
Defense.gov News Photo 120308-N-PB383-515 - Petty Officer 1st Class Allen Lunn a line coach gives Seaman Brittany Koval instruction on how to fire an M-16 service rifle during a live-fire
pictures featuring members of the 11th marine expeditionary unitimages from united states navy to check
Gladiateur Begram Guimet 18117
1st-century glassware in franceancient greek glassware
US Navy 110331-N-NB544-020 Damage Controlman Fireman Devon Ely, left, holds a filter for Machinist's Mate 1st Class Margaret Huff as she uses an IM
3m 6000-series full-facepiece reusable respiratorspeople
US Navy 050526-N-3019M-005 Engineman 1st Class Noah Lanham, assigned to the dock landing ship USS Rushmore (LSD 47), holds his wife's hands
peoplegroup
US Navy 060830-N-4097B-014 U.S. Army Lt. Alan Boyes, right, with Charlie Company, 1st Battalion, 68th Armored Regiment, 4th Infantry Division, shakes the hand of an Iraqi army soldier
4th infantry division (united states)forward operating base warhorse
US Navy 060611-N-2832L-056 U.S. Military Sealift Command (MSC) Hospital Ship USNS Mercy (T-AH 19) anchors off the city coast, while the ship and her crew begin their 1st day of humanitarian aid
waterboat
US Navy 070817-N-0194K-010 Builder 2nd Class Charles Page and Hospital Corpsman 1st Class Jose Afable, both attached to Military Sealift Command hospital ship USNS Comfort (T-AH 20), help a patient across the courtyard of Angel
builder (united states navy)people
US Navy 070902-N-8704K-091 Canadian Army Lt. Anne Marie Lambert and Hospital Corpsman 1st Class Julie Urban, both attached to Military Sealift Command hospital ship USNS Comfort (T-AH 20), check in Famillis Gillain to Hopital D
2007 in port-au-princeport-au-prince
US Navy 080711-N-6764G-464 Fire Controlman 1st Class Kevin Sanders inspects the bullet feed for a .50-caliber machine gun during a warning and disabling fire exercise aboard the amphibious transport dock ship USS San Antonio (L
.50 bmg ammunition beltsfire controlman
US Navy 080719-N-9623R-005 Builder 2nd Class Thomas, left, and Builder 1st Class Steven Vargas, both assigned to Naval Mobile Construction Battalion (NMCB) 17, check the square of a South Western Asia (SWA) hut foundation
builder (united states navy)wood
US Navy 081205-N-6278K-123 Explosive Ordnance Technician 1st Class Aaron Ritter, assigned to Explosive Ordnance Disposal Mobile Unit (EODMU) 1, uses a miniature mine detector to search for unexploded ordnance in Tikrit, Iraq
militaryarmy
US Navy 091127-N-4154B-130 Navy Diver 1st Class Daniel Muhlbach, assigned to Mobile Diving and Salvage Unit (MDSU) 2, comes out of the water during a search for the body of U.S. Army Sgt. Brandon Islip
water sportwater
US Navy 100115-N-6247V-103 Senior Airman Lesley Moore, left, of Dayton, Ohio, and Airman 1st Class Stephanie Thibodeau of Milwaukee, Wis., await further orders at the Port-Au-Prince airport
january 2010 in port-au-princejerrycan
US Navy 100328-N-5366K-130 Chief Special Warfare Operator (SEAL) Justin Gauny, left, and Aircrew Survival Equipmentman 1st Class Victor Maldonado, assigned to the U.S. Navy parachute demonstration team, the Leap Frogs, prepare
arizonafly
US Navy 100407-N-6138K-005 Damage Controlman 1st Class Corry Webb, from Dearborn Heights, Mich., teaches sailors from Gambia, Liberia, and Sierra Leone the proper procedure for measuring shoring
architecturepeople
US Navy 100630-N-6003P-118 Aviation Electronics Technician 1st Class Jeffrey Caleb, right, and Aviation Electronics Technician 3rd Class Adam Chenevert conduct an ALE-47 Airborne Countermeasure Dispensing System inspection
aircraftvehicle
US Navy 100905-N-4044H-129 Hospital Corpsman 1st Class Leo Rodriguez, left, embarked aboard the Royal Australian Navy landing ship heavy HMAS Tobruk (L50), kicks a soccer ball during a community service event
aboard usns mercy (t-ah-19)grass
US Navy 090717-N-5538K-093 Boatswain's Mate 1st Class Louis M. Peters guides a landing craft air cushion out of the well deck of the amphibious transport dock ship USS Denver (LPD 9) during a Talisman Saber 2009 training exerci
boatswain's mate (united states navy)talisman sabre 2009
US Navy 040422-G-0000S-001 Coast Guard Machinery Technician 1st Class Simon Sandoval, of Tucumcari, N.M., provides security for Queen Mary II
vehiclewater
US Navy 041024-N-1159B-007 Engineman 1st Class Ronnie Choate adjusts a model of OS2U Kingfisher seaplane aboard a large-scale model of the battleship Nevada (BB 36)
californianavy
US Navy 041026-N-3228G-002 Hull Maintenance Technician 1st Class Martin Mantz of Center, N.D., left, and Hull Maintenance Technician 2nd Class Gary Chavez of Portage, Ind., talk to reporters at a press conference about their re
united states navy images from pearl harborpeople at pearl harbor
US Navy 051121-F-7234P-021 After getting most of the drill assembly together, U.S. Navy Petty Officer 2nd Class Joseph McCarthy and Petty Officer 1st Class Ryan Barker head to get the remaining parts at a U.S. military camp in
naval mobile construction battalion 3photographs by stacy l. pearsall
US Navy 080915-N-7544A-057 Aviation Machinists Mate 3rd Class Sean Stout and Aviation Structural Mechanic 1st Class John Graham perform maintenance on a MH-60R Sea Hawk helicopter
militaryvehicle
Finials, 1 of 2, excavated in Luristan, Iran, late 2nd to early 1st millenium BC, bronze - Tokyo National Museum - Tokyo, Japan - DSC08566
self-published workgold
Dotaku (bell-shaped bronze), excavated at 1-15 Kamo, Kawanishi-shi, Hyogo, Japan, Yayoi period, 1st-3rd century AD, bronze - Tokyo National Museum - Tokyo, Japan - DSC09156 (cropped)
self-published workcc-pd-mark
Dotaku (bell-shaped bronze), excavated at 1-15 Kamo, Kawanishi-shi, Hyogo, Yayoi period, 1st-3rd century AD, bronze - Tokyo National Museum - Ueno Park, Tokyo, Japan - DSC09109
self-published workcc-pd-mark
US Navy 091005-N-0890S-124 Craftmaster Boatswain's Mate 1st Class David Lewis assigned to Assault Craft Unit (ACU) 2 steers Landing Craft Unit (LCU) 1653
aboard uss wasp (lhd-1)1970
US Navy 071105-N-0193M-500 Boatswain's Mate 1st Class Jay Collette directs line handlers from the flight deck of USS Fort McHenry (LSD 43) during the Africa Partnership Station (APS) arrival in Dakar, Senegal
aboard uss fort mchenry (lsd-43)walkie talkie
US Navy 090416-N-4515N-021 Culinary Specialist 1st Class William Foster, assigned to Cross Hall Galley in Groton, Conn., butchers a slab of beef during the first Navy Region Mid-Atlantic Iron Chef Competition at Naval Station N
culinary specialist (united states navy)naval station norfolk
US Navy 090418-N-9950J-236 Postal Clerk 1st Class Brian Garfield, assigned to the amphibious assault ship USS Essex (LHD 2), works with Philippine sailors to move supplies at Barretto National High School during a community ser
aboard uss essex (lhd-2)balikatan 2009
1st Baron Carlingford, published 1883
chichester parkinson-fortescue, 1st baron carlingfordlock & whitfield
William Cecil, 1st Baron Burghley, Marcus Gheeraerts the Younger, between 1585 and 1598
male portrait paintings by marcus gheeraerts (ii)william cecil, 1st baron burghley
Sir John Beverley Robinson, George Theodore Berthon
george théodore berthonupper canada
Pożegnanie przechodzącego w stan spoczynku gen. Lucjana Żeligowskiego (22-283), Edward Rydz-Śmigły, 27 October 1927
kazimierz sosnkowskitadeusz kutrzeba
8501 - 8600 of 19,441 Next page
/ 195