35,053 Free Images of C

cc-zerocc-pd-markfiles uploaded by daderotauthor died more than 100 years ago public domain imagesplantsvehicleaircraftnavybirdturkey
Tripod cylindrical vessel depicting an enthroned lord with glyphic text, Maya, northern Maya lowlands, Mexico, Late Classic period, c. 600-900 AD, ceramic - Dallas Museum of Art - DSC04644
self-published workcc-pd-mark
Vases and butter dish, designer Joseph Maria Olbrich, Metallwarenfabrik Eduard Hueck, c. 1901-1902, tin, glass - Museum Künstlerkolonie Darmstadt - Mathildenhöhe - Darmstadt, Germany - DSC06306
self-published workcc-pd-mark
ROCAF C-130H 1318 Taxiing at Ching Chuang Kang Air Force Base 20140719e
militaryvehicle
Pair of vases, 1769, with central vase, c. 1766-1770, painted by Charles-Nicolas Dodin after Francois Boucher, Sèvres porcelain, soft-paste porcelain - Wadsworth Atheneum - Hartford, CT - DSC05276
self-published workgold
The Betrayal of Christ, British, Nottingham, c. 1500, alabaster with paint - Middlebury College Museum of Art - Middlebury, VT - DSC08081
self-published workcc-pd-mark
Two-handled perforated decanter bottle or perfume-brazier vessel, Jules Ziegler, France, c. 1840, salt-glazed stoneware - Montreal Museum of Fine Arts - Montreal, Canada - DSC09284
self-published workcc-pd-mark
Afghan Air Force humanitarian mission (4738068529)
militaryvehicle
A-7E A-4M A-6E AV-8C over NAS China Lake 1981
militaryvehicle
Adoration of the Shepherds, by Domenico Piola, Genoa, c. 1650-1655, oil on canvas - Blanton Museum of Art - Austin, Texas - DSC07988
17th-century religious paintings in the united states1650s religious paintings
Folio from a Haft Awrang (Seven Thrones) by Jami, calligraphy by Muhhib Ali, Iran, Safavid period, c. 1557 AD, ink, color, gold, paper - Freer Gallery of Art - DSC04689
self-published workcc-pd-mark
Gorget, Peru, north coast, Chimu style, c. 1350-1450 AD, feathers, reeds, copper bars, silver, metal overlaid with skin - Textile Museum, George Washington University - DSC09898
self-published workcc-pd-mark
Filing cabinet for Philip V of Spain, by Hendrick van Soest, Antwerp, c. 1713, marquetry of tortoise shell, jacaranda, ebonized wood, tin, bronze - Museo Nacional de Artes Decorativas - Madrid, Spain - DSC08451
self-published workcc-pd-mark
Ferdinando de' Medici, Grand Prince of Tuscany, by Giovanni Battista Foggini, Italy, Florence, c. 1680-1682, marble - Metropolitan Museum of Art - New York City - DSC07035
self-published workcc-pd-mark
Globe clock by Philipp Gottfried Schaudt, c. 1785, wood, enamel, brass, steel, iron, view 1 - Hessisches Landesmuseum Darmstadt - Darmstadt, Germany - DSC00470
self-published workgold
Beaker, Louis F. Vaupel, New England Glass Company, c. 1860-1875, blown, ruby-cased glass, cut and engraved - Museum of Fine Arts, Boston - 20180922 153817
self-published workcc-pd-mark
Armchair, 1660-1685, wood and cane, with An Unknown Girl, formerly called 'Minette', possibly by Theodore Russel, London, c. 1640, oil on panel - Packwood House - Warwickshire, England - DSC09040
self-published workcc-pd-mark
Bonaparte Entering Cairo, by Jean-Leon Gerome, c. 1897, multi-patinated bronze - Montreal Museum of Fine Arts - Montreal, Canada - DSC08775
self-published workcc-pd-mark
Battle scene with three hoplites, neck amphora, attributed to the Leagros Group, c. 510-500 BC, black-figure terracotta - Blanton Museum of Art - Austin, Texas - DSC07642
self-published workcc-pd-mark
Cylinder jar, Egyptian, Early Dynastic period, 1st to 2nd dynasty, c. 310-2686 BC, terracotta - Middlebury College Museum of Art - Middlebury, VT - DSC08062
self-published workcc-pd-mark
Drinking vessel in the form of a conch shell with emerging Moche god, Peru, Moche IV, north coast, c. 400 AD, earthenware with slip glaze - Krannert Art Museum, UIUC - DSC06509
self-published workcc-pd-mark
Duck, Rhodes, c. 580 BC, L 148 - Martin von Wagner Museum - Würzburg, Germany - DSC05748
self-published workcc-pd-mark
Eye cup, attributed by J. D. Beazley to the Group of Walters 48.42, Greek, Attic, c. 510 BC, terracotta - Middlebury College Museum of Art - Middlebury, VT - DSC08023
self-published workcc-pd-mark
Elliptical side table, John Linnell, designer, England, c. 1775, satinwood, gilt bronze mounts - California Palace of the Legion of Honor - San Francisco, CA - DSC02826
console tableindoor
Dining Room, with capriccios of ruins by Pietro Paltronieri, called Il Mirandolese dalle Prospettive, c. 1740-1777, tempera and oil on canvas - Shugborough Hall - Staffordshire, England - DSC00316
self-published workinterior
Dionysus seated between two satyrs, kyathos in an Etruscan shape, Greek-Attic, c. 510-485 BC, black-figure terracotta - Blanton Museum of Art - Austin, Texas - DSC07651
self-published workbowl
Album leaf (muraqqa'), signed Muhammad Husayn (Mulla Muhammad Husayn Tabrizi), Iran, Qazvin, c. 1575 AD, ink, watercolour, and gold on paper - Aga Khan Museum - Toronto, Canada - DSC06883
self-published workcc-pd-mark
Bracelet, Peru, Chancay or Chimu, central or north coast, c. 1000-1470 AD, nut hull, cotton cord, bone, shell - Krannert Art Museum, UIUC - DSC06460
self-published workbone objects
Coffee urn, 10-cup with sash weight as warmer, Leonard, Reed & Barton pattern 3400, c. 1837-1847, Britannia metal, steel, wood - Old Colony History Museum - Taunton, Massachusetts - DSC03801
self-published workcc-pd-mark
Bacchus and His Tiger, Wedgwood & Bentley, England, c. 1772-1775, black stoneware - Montreal Museum of Fine Arts - Montreal, Canada - DSC09190
self-published workcc-pd-mark
Clock by David Roentgen, movement attrib. Elie Prudhomme, Germany, Neuwied-at-the-Rhine, c. 1780-1790, woods, brass, gilt bronze, enamel, 2002.237 - Metropolitan Museum of Art - New York City - DSC07640
self-published workcc-pd-mark
Brig Cadet in Gloucester Harbor, by Fitz Henry Lane, c. late 1840s, oil on canvas - Cape Ann Museum - Gloucester, MA - DSC01132
vehiclewater
Crown, Peru, north coast, Chimu style, c. 1350-1450 AD, feathers, reeds, copper bars, silver, metal overlaid with skin - Textile Museum, George Washington University - DSC09890
self-published workcc-pd-mark
Martin-Wasp Touring Car, view 8, designed by Karl Hamlin Martin, made by Martin-Wasp Corporation, c. 1924, Bennington VT - Bennington Museum - Bennington, VT - DSC09075
vehiclecar
Lidded bowl with Itzamna riding a peccary, Maya, southern Maya lowlands, probably Campeche state, Mexico, c. 200-450 AD, ceramic - Dallas Museum of Art - DSC04718
self-published workcc-pd-mark
Madonna and Child, follower of Bartolomeo Suardi, called Bramantino, Milan, c. 1500, oil on panel - Blanton Museum of Art - Austin, Texas - DSC07721
self-published workcc-pd-mark
Longcase clock (case only), movement by Andrew Padbery of Bishop's Waltham, c. 1750, commemorating the 1st battle of Finisterre - Swallow Passage - Shugborough Hall - Staffordshire, England - DSC00363
self-published workcc-pd-mark
Neck amphora with Herakles battling Triton, Athens, c. 510 BC, L 189 - Martin von Wagner Museum - Würzburg, Germany - DSC05541
self-published workcc-pd-mark
Musical automaton clock, movement by Jan Carel Lambreghts before 1751, Antwerp, c. 1777, gilt metal, bronze, copper silver, cut glass paste, enamel - Metropolitan Museum of Art - New York City - DSC07045
self-published workgold
Neck amphora with boxers training, Attic, c. 530 BC, L 173 - Martin von Wagner Museum - Würzburg, Germany - DSC05524
self-published workcc-pd-mark
Melon Sweet Flavor plantations in Candaba, Pampanga Cucumis melo cantaloupe group fields in the Philippines Known-You Seed Co., LTD. Known-You Seed Co., LTD., Zhuliao Road, Dashu District, Kaohsiung C
plantsgrass
US Navy 030516-N-1328C-505 An Acrobatic Group of Spain aircraft perform aerial maneuvers over USS Theodore Roosevelt (CVN 71), anchored off the coast of Cartagena, Spain
vehicleboat
US Navy 070521-N-1082Z-005 Lt. Cmdr. John Fisher greets his wife and seven-month-old daughter at a flight line homecoming on Naval Station Norfolk after returning with the Rawhides of Fleet Logistics Support Squadron (VRC) 40
flight deck of uss dwight d. eisenhower (cvn-69)naval station norfolk
US Navy 070531-N-3038W-036 Catapult safety observer, Aviation Boatswain's Mate (Equipment) 1st Class Daniel Brandau, signals that an F-A-18C Hornet assigned to the Argonauts of Strike Fighter Squadron (VFA) 147 is ready for lau
equipmentnavy
US Navy 060327-N-6074Y-003 Lt. Greg C. Knutson, a pilot assigned to Helicopter Anti-Submarine Squadron Two (HS-2) Golden Falcons, briefs fellow pilots and air crew prior to an evening combat search and rescue (CSAR) training mi
grouposan
US Navy 050330-C-0000B-500 A U.S. Coast Guard Air Station Sitka, Alaska HH-60J Jayhawk helicopter crew circles the Alaska Marine Highways Systems ferry Kennicott prior to airlifting a 69-year-old patient 65-miles northwest of
united states navy images from alaskahelihoisting of people
US Navy 070725-N-3729H-075 An EA-6B Prowler, attached to the Yellow Jackets of Electronic Attack Squadron (VAQ) 138, is directed onto the catapult as it prepares to launch off the flight deck of Nimitz-class aircraft carrier US
aircraftvehicle
US Navy 070725-N-3729H-085 An EA-6B Prowler, attached to the Yellow Jackets of Electronic Attack Squadron (VAQ) 138, is directed onto the catapult as it prepares to launch off the flight deck of Nimitz-class aircraft carrier US
aircraftvehicle
US Navy 070829-N-9909C-003 Guided-missile destroyer USS Preble (DDG 88) rounds the pier at Naval Base San Diego after returning from a 7.5-month deployment as part of John C. Stennis Carrier Strike Group
boatship
US Navy 080828-N-9076B-002 The aircraft carrier USS Kitty Hawk (CV 63) pulls away from the pier at Naval Air Station North Island Calif
vehicleship
US Navy 090724-N-8273J-014 Chief of Naval Operations (CNO) Adm. Gary Roughead salutes during the presentation of colors during the change of command ceremony for U.S. Fleet Forces Adm. Jonathan W. Greenert and Adm. John C. Harv
aboard uss harry s. truman (cvn-75)naval station norfolk
US Navy 111203-N-BT887-402 An F-A-18C Hornet assigned to the Golden Dragons of Strike Fighter Squadron (VFA) 192 launches from the Nimitz-class air
militaryvehicle
Defense.gov News Photo 110816-N-BT887-045 - U.S. Navy Petty Officer 2nd Class Adam Zimniak collects chains removed from an F A-18E Super Hornet aircraft aboard the aircraft carrier USS John
uss john c. stennis (cvn-74) flight deckf/a-18e super hornet on flight decks
Treasure moss seaweed
animalstravel
Nawad Nasar al-Doulah, possibly Hyderabad school, India, c. mid 1800s AD, opaque watercolor on paper - Tokyo National Museum - Tokyo, Japan - DSC08827
self-published workyellow
Orange tree trunk fruit orange tree
foodtree
Pilgrim flask, Cypriot, Cypro-Geometric II-III, c. 950-750 BC, terracotta - Middlebury College Museum of Art - Middlebury, VT - DSC07991
self-published workbrown
Close-ups of a) Salvia, Family Lamiaceae Salvia Salvia splendens F. Sellow ex R. & S. Scarlet Sage Xiang ya hong, b) Dwarf Sunflowers, c) Aster (genus) d) Dwarf Zinia in Barangays Pagala, 14°58'14
naturespring
Close-ups of a) Salvia, Family Lamiaceae Salvia Salvia splendens F. Sellow ex R. & S. Scarlet Sage Xiang ya hong, b) Dwarf Sunflowers, c) Aster (genus) d) Dwarf Zinia in Barangays Pagala, 14°58'14
plantsflower
Close-ups of a) Salvia, Family Lamiaceae Salvia Salvia splendens F. Sellow ex R. & S. Scarlet Sage Xiang ya hong, b) Dwarf Sunflowers, c) Aster (genus) d) Dwarf Zinia in Barangays Pagala, 14°58'14
natureplants
Stejar pedunculat, monument al naturii amplasat în mun. Chișinău, str. George Enescu 5, grădina publică dendrologică (cod MD-C-mn.Cb-132) This is a photo of a natural heritage site in Moldova
plantstree
Slant-top desk, Abraham & David Roentgen, Neuwied, Germany, c. 1765-1768, pine, walnut, maple, barberry, boxwood, spindle, rosewood, holly, beech - Germanisches Nationalmuseum - Nuremberg, Germany - DSC02551
self-published workindoor
Pair of George III pedestals and urns, 2 of 2, England, c. 1790, mahogany - Great House - Castle Hill on the Crane Estate - Ipswich, Massachusetts - DSC06193
interior designinterior
Sacrifice of Isaac, by Jacopo da Ponte, called Bassano, c. 1574-1575, oil on canvas - Blanton Museum of Art - Austin, Texas - DSC07768
self-published workcc-pd-mark
Dish filled with peas and pease blossom; bone china painted with enamels and gilded. Made by Minton & Co., Stoke-on-Trent, c. 1825 Victoria and Albert Museum, London, museum no. 414:810/A-1885 (L
plantspea
La Jardin Baliwag Home of Divine Mercy & Retreat House (Catulinan, Baliuag, Bulacan) 14°58'5"N 120°52'36"E Siling mahaba Sileng-haba (Tag.) Capsicum annuum Banana peppers var. longum C. annuum v
plantsbird
La Jardin Baliwag Home of Divine Mercy & Retreat House (Catulinan, Baliuag, Bulacan) 14°58'5"N 120°52'36"E Siling mahaba Sileng-haba (Tag.) Capsicum annuum Banana peppers var. longum C. annuum v
plantsbird
La Jardin Baliwag Home of Divine Mercy & Retreat House (Catulinan, Baliuag, Bulacan) 14°58'5"N 120°52'36"E Siling mahaba Sileng-haba (Tag.) Capsicum annuum Banana peppers var. longum C. annuum v
plantsbird
La Jardin Baliwag Home of Divine Mercy & Retreat House (Catulinan, Baliuag, Bulacan) 14°58'5"N 120°52'36"E Siling mahaba Sileng-haba (Tag.) Capsicum annuum Banana peppers var. longum C. annuum v
plantsgarden
La Jardin Baliwag Home of Divine Mercy & Retreat House (Catulinan, Baliuag, Bulacan) 14°58'5"N 120°52'36"E Siling mahaba Sileng-haba (Tag.) Capsicum annuum Banana peppers var. longum C. annuum v
plantsbird
La Jardin Baliwag Home of Divine Mercy & Retreat House (Catulinan, Baliuag, Bulacan) 14°58'5"N 120°52'36"E Siling mahaba Sileng-haba (Tag.) Capsicum annuum Banana peppers var. longum C. annuum v
plantsbird
La Jardin Baliwag Home of Divine Mercy & Retreat House (Catulinan, Baliuag, Bulacan) 14°58'5"N 120°52'36"E Siling mahaba Sileng-haba (Tag.) Capsicum annuum Banana peppers var. longum C. annuum v
plantsbird
La Jardin Baliwag Home of Divine Mercy & Retreat House (Catulinan, Baliuag, Bulacan) 14°58'5"N 120°52'36"E Siling mahaba Sileng-haba (Tag.) Capsicum annuum Banana peppers var. longum C. annuum v
plantsbird
La Jardin Baliwag Home of Divine Mercy & Retreat House (Catulinan, Baliuag, Bulacan) 14°58'5"N 120°52'36"E Siling mahaba Sileng-haba (Tag.) Capsicum annuum Banana peppers var. longum C. annuum v
plantsbird
ROCAF C-130H 1319 Display at Ching Chuang Kang AFB 20140719b
militaryvehicle
Figure 2; New scleractinian records for American Sāmoa. a Acanthastrea subechinata Veron, 2000 b Favites paraflexuosus Veron, 2000 c Echinophyllia echinoporoides Veron & Pichon, 1980 d Turbinaria
underwatersea
pl m VOL V C. J. Broinowski. Fecit I ACANTH 1 2A NANA (V^aHorsF) Little Acanth, 3 a. 3 ACANTH I ZA MAGNA, (Gouid) Great Acanth^a. 2 ACANTH I ZA LINE ATA (Gould) Striated Acanth^a- 4 GEOBr\SIL
animalsbird
Two Fish, China, Western Zhou period, (24) 11th-10th century BC, stone, (25) c. 1050-771 BC, nephrite - Arthur M. Sackler Museum, Harvard University - DSC00770
self-published workcc-pd-mark
The Christ Child and the Young Saint John the Baptist in a Landscape, by Francesco Albani, c. 1633, oil on copper - Blanton Museum of Art - Austin, Texas - DSC07877
self-published workcc-pd-mark
Madonna Surrounded by Saints (The Aldobrandini Triptych), by a follower of Bernardo Daddi, c. 1336, tempera on wood - Portland Art Museum - Portland, Oregon - DSC09049
self-published workarchitecture
US Navy 070318-N-5961C-237 Japan Maritime Self Defense Force (JMSDF) ship JS Haruna (DDH 141), USS Russell (DDG 59) and USS Ronald Reagan (CVN 76) steam in formation during a photo exercise (PHOTOEX) between the Ronald Reagan C
general views of uss russell (ddg-59)sea
US Navy 070128-N-3729H-129 An SH-60F Seahawk assigned to the Eightballers of Helicopter Anti-Submarine Squadron Eight (HS-8) is directed to the landing area by a landing signalman enlisted
aircraftflight
US Navy 080718-N-8467N-006 Capt. Kenneth M. Perry, right, and Captain Robert P. Burke shake hands after Perry reports to Rear Adm. Bruce E. Grooms, commander, Submarine Group Two, center, that he has been relieved by Burke as c
handshakes involving the militaryarmy
US Navy 090616-N-2475A-106 An MH-60S Sea Hawk from the Eightballers of Helicopter Sea Combat Squadron (HSC) 8 hovers over the flight deck of USNS Bridge (T-AOE 10) to pick up pallets of supplies for transfer
shipsea
US Navy 050217-N-9866B-003 Aviation Boatswain's Mates work together on top of a AV-8A Harrier training aircraft as a crane hoist is attached to the aircraft during training drills on the flight deck aboard the amphibious assaul
aircraftvehicle
US Navy 070829-N-9909C-005 Lt. Charlie Limon, force protection officer aboard guided-missile destroyer USS Preble (DDG 88), meets his son for the first time after returning from a 7.5-month deployment as part of John C. Stennis
celebritiesgroup
US Navy 110702-N-KF029-022 Aircraft assigned to Carrier Air Wing (CVW) 14 prepare to catapult from the aircraft carrier USS Ronald Reagan (CVN 76)
militaryvehicle
US Navy 110517-N-BT887-024 Aviation Ordnanceman Airman Tiffany Wilchek, from Lemoore, Calif., dismantles a rescue hoist on an MH-60S Sea Hawk helic
aircraftvehicle
US Navy 110811-N-DS193-002 An E-2C Hawkeye assigned to the Liberty Bells of Airborne Early Warning Squadron (VAW) 115 launches from the aircraft c
aircraftvehicle
Defense.gov News Photo 111214-N-BT887-391 - U.S. Navy sailors wipe down the canopy of an F A-18F Super Hornet aircraft attached to Strike Fighter Squadron 41 aboard the aircraft carrier USS
uss john c. stennis (cvn-74) flight decknavy
DIG13766-011 - Ladies and Gentlemen... the Beatles! exhibit at LBJ Presidential Library, Austin, TX, 2015-06-23 16.12.32
rock-and-rollinside
Christ Child Playing with a Finch, by Guido Reni, Bologna, c. 1634-1645, oil on canvas - Blanton Museum of Art - Austin, Texas - DSC07891
self-published workcc-pd-mark
Christ from a Flagellation, by Hans Christoph Schenck, c. 1640, boxwood - Bode-Museum - DSC02905
self-published workcc-pd-mark
Bowl, Iran, Safavid period, c. 1600 AD, pottery, polychrome on white engobe under transparent glaze - Montreal Museum of Fine Arts - Montreal, Canada - DSC09729
platefood
Bull Sacrifice, column krater, by a Pupil of the Nikoxenos Painter, c. 500 BC, painted terracotta - Portland Art Museum - Portland, Oregon - DSC09009
self-published workcc-pd-mark
Belly amphora with Herakles wrestling Triton, Attic, c. 540 BC, L 263 - Martin von Wagner Museum - Würzburg, Germany - DSC05543
self-published workcc-pd-mark
Book cover with evangelists, Köln, ivory from 1150-1175, surround c. 1580, walrus tooth, gilt copper, enamel - Hessisches Landesmuseum Darmstadt - Darmstadt, Germany - DSC00257
treasure bindinggold
Aztec tete-a-tete coffee service, 3 of 3, commissioned by William Randolph Hearst, Tiffany & Co., New York City, c. 1897, silver, ivory - Dallas Museum of Art - DSC04855
metalgold
Album leaf (muraqqa') of nasta'liq calligraphy with drawing of seated dervish, Iran, c. 1500-1550 AD, ink, watercolour, and gold on paper - Aga Khan Museum - Toronto, Canada - DSC06874
self-published workcc-pd-mark
Alabastron with African warrior, Group of the Negro Alabastra, Greek, Attic, c. 500 BC, white-ground technique on earthenware - Krannert Art Museum, UIUC - DSC06531
self-published workcc-pd-mark
Rev Littles C Bluff IA
grassroof
18701 - 18800 of 35,053 Next page
/ 351