17,896 Free Images of Chief

images from the chairman of the joint chiefs of staff flickr stream4-11 nov. 2019 - seac visits romania and hungarymilitaryarmyvehiclelandscapeaircraftuss john c. stennis (cvn-74)mountainunited service organizations in the 2010s
Tippi fur campfire
fantasywarrior
President Monroe picture, Vann House, Sept 2017
self-published workinterior
191111-D-SW162-1088 (49054500083)
militaryarmy
190401-D-SW162-2415 (47526508721)
lightnight
Director of the Office of the Chief Management Officer within the Department of the Navy Ms. Alaleh Jenkins visited with Rear Adm. Jonathan Yuen
alaleh a. jenkinsjonathan a. yuen
Command Master Chief waves from the submarine float during Guam's 72nd Liberation Day Parade. (28168174490)
liberation day in guamjuly 2016 in guam
Hk-nearly-300-pan-democratic-ec-members-will-pick-tsang-follow-popvote-1
chief executive election civil referendum 2017benny tai yiu ting in 2017
John Troxell 191105-D-SW162-1026 (49021504968)
images from the chairman of the joint chiefs of staff flickr stream4-11 nov. 2019 - seac visits romania and hungary
191106-D-SW162-1275 (49026481731)
militaryarmy
191106-D-SW162-1447 (49025964483)
images from the chairman of the joint chiefs of staff flickr streamvehicle
191108-D-SW162-1052 (49034486176)
landscapemountain
191106-D-SW162-1458 (49025963983)
militaryarmy
200106-D-SW162-1060 (49341479342)
images from the chairman of the joint chiefs of staff flickr streammilitary
Maj Gen Robert A. Breitweiser
surveillancemonochrome
Lt Gen Joseph L. Lengyel
list of united states air force three-star generals since 2010joseph l. lengyel
190401-D-SW162-1778 (46786811604)
militaryvehicle
181223-D-PB383-015 (44618614970)
uss john c. stennis (cvn-74)people
181224-D-PB383-093 (45727528844)
winterlight
US Navy 110519-N-AD372-326 Sailors of the year stand at attention before their meritorious advancement to chief petty officer
people at the united states navy memorialstreet scene
US Navy 110610-N-ZB612-105 Chief of Naval Operations (CNO) Adm. Gary Roughead attends the U.S. Naval War College graduation ceremony. (
naval war college
US Navy 110815-N-AU127-446 Chief selectees march to the USS Constitution
vehiclewater
US Navy 101001-N-6764G-032 Chief of Information Rear Adm. Dennis Moynihan talks with officers, enlisted and civilians in the Navy's public affairs
naval station norfolkgroup
US Navy 030604-N-0000W-003 Chief Dental Technician Martin Stroud carries a simulated casualty into the Naval Hospital
rescue trainingarmy
US Navy 100217-N-3283P-019 Members of the Far East Chief Petty Officer (CPO) Mess participate in the monthly CPO Pride Run
yokosuka naval base in the 2010s
US Navy 100816-N-6676S-023 Chief petty officer (CPO) selectees listen to a tour guide explain the history of The Lone Sailor statue
norfolk virginiathe lone sailor
US Navy 030116-N-5319A-002 Adm. Vern Clark, Chief of Naval Operations (CNO), speaks with Sailors and Marines assigned to Naval Support Activity, Bahrain
vern clark
US Navy 030116-N-5319A-003 Adm. Vern Clark, Chief of Naval Operations (CNO), speaks with Sailors and Marines assigned to Naval Support Activity, Bahrain
vern clark
US Navy 030320-D-9880W-018 U.S. Air Force Gen. Richard B. Myers, Chairman of the Joint Chiefs of Staff
pentagon press briefing roomrichard myers
US Navy 120109-N-DR144-061 Chief Machinist's Mate Daniel Pike helps a Sailor don a firefighting ensemble
aboard uss carl vinson (cvn-70)people
US Navy 110916-N-KV696-201 One of the newest National Capital Region chief petty officers receives his anchors from his family
leutze parklawn
US Navy 111019-N-FC670-064 Chief of Naval Operations (CNO) Adm. Jonathan Greenert delivers the opening remarks at the 20th International Seapower S
international seapower symposium
USS John C. Stennis Chief selectees clean Retsil Veterans Home 160901-N-EC099-084
uss john c. stennis (cvn-74)washington veterans home
Indonesian Army Chief of Staff Gen. Andika Perkasa Participates in an Army Full Honors Wreath-Laying Ceremony at the Tomb of the Unknown Soldier - 49483796507
city lifepeople
John Troxell 191111-D-SW162-1247 (49054499148)
images from the chairman of the joint chiefs of staff flickr stream4-11 nov. 2019 - seac visits romania and hungary
Defense.gov News Photo 090618-N-0696M-046
chairman of the joint chiefs of staffmichael g. mullen in 2009
200109-D-SW162-0009 (49358568902)
militaryvehicle
200302-D-WD757-0005 (49613111267)
militaryvehicle
190820-D-PB383-006 (48588114106)
aircraftvehicle
190820-D-PB383-028 (48588111506)
aircraftvehicle
190820-D-PB383-026 (48588111691)
aircraftvehicle
191105-D-SW162-1095 (49022226377)
militaryarmy
191111-D-SW162-1079 (49055014276)
militaryarmy
191108-D-SW162-1361 (49033980893)
countrysidelandscape
190529-D-SW162-1409 (47974253087)
landscapenature
SEAC visits Southern Border (47972093966)
aircraftvehicle
Senior Chief Special Warfare Operator (SEAL) Edward C. Byers Jr. speaks to media after receiving the Medal of Honor (24756817283)
medal of honor presentation ceremony for edward byers
191106-D-SW162-1187 (49025970688)
militaryarmy
191106-D-SW162-1510 (49026685392)
sidewalkpavement
191108-D-SW162-1002 (49034710552)
landscapemountain
191108-D-SW162-1095 (49034706852)
landscapemountain
191108-D-SW162-1035 (49034708607)
landscapemountain
191107-D-SW162-1011 (49030603131)
militaryarmy
Hk ce election nomination period and civil nomination 2
chief executive election civil referendum 2017ip kin-yuen
US Navy 070717-N-0696M-041 Vice Chief of Naval Operations (CNO) Adm. Patrick Walsh greets the 2007 Sailors of the Year
interior of the pentagonpatrick m. walsh
US Navy 081006-N-9623R-012 Command Master Chief James Heiland prepares to board a Marine CH-56 helicopter
united states navy in the iraq warpeople
US Navy 110323-N-RC734-062 Chief Engineman Jose Avena, a member of the Damage Control Training Team, debriefs Sailors
aboard uss comstock (lsd-45)people
US Navy 110201-N-2984R-009 Chief Master-at-Arms Rodrigo Celones demonstrates proper striking techniques to a group of Guatemalan sailors participat
us navy in puerto quetzal
US Navy 110510-N-CD297-009 Retired Chief Operations Specialist Gerald Wayne Williams demonstrates wheelchair handling techniques during basketball
wheelchair basketballwarrior games
USS Bonhomme Richard (LHD 6) Chief of Chaplains Tour 161129-N-TH560-121
guests aboard uss bonhomme richard (lhd-6)navy
US Navy 101104-N-8816D-003 Chief Construction Mechanic James Sawyer participates in a training patrol during a khaki field training exercise
militaryarmy
Chief of Naval Operations visits Japan. DVIDS52646
united states navy images from tokyomichael g. mullen in 2007
181026-D-SW162-1033 (45570368601)
officerarmy
181223-D-PB383-057 (45522454125)
uss john c. stennis (cvn-74)red
181224-D-PB383-059 (46450881541)
sidewalkpavement
USS John C. Stennis Chief selectees clean Retsil Veterans Home 160901-N-EC099-137
uss john c. stennis (cvn-74)washington veterans home
CJCS meets with Albanian President (37099270751)
peoplejr
US Navy 111019-N-FC670-032 Chief of Naval Operations (CNO) Adm. Jonathan Greenert delivers the opening remarks at the 20th International Seapower S
international seapower symposium
Blason ville fr Saint-Nazaire (Loire-Atlantique) v2
files with no machine-readable authorself-published work
Sir James Dyer from NPG
chief justice of the common pleaslondon
Sir Randall Crewe LCJ
golden inscriptions in portrait paintingsnantwich
Stapleton Cotton, 1st Viscount Combermere by Mary Martha Pearson (née Dutton)
londonindia
Louis XV by Maurice-Quentin de La Tour
louis xv1710
Asti-Stemma fascista
vector images using elements from other vector imagesself-published work
Blason ville fr Loyettes (Ain)
self-published workazure
Robert Cecil, 1st Earl of Salisbury by John De Critz the Elder (2)
coats of arms of queen elizabeth i of englandlondon
Peter King, 1st Baron King of Ockham by Daniel De Coning
chief justice of the common pleaslondon
Edward VII in coronation robes
cambridge1902
Blason ville fr Grand-Auverné (Loire-Atlantique)
self-published workchevron
Blason de la ville de Ostricourt (59) Nord-France
unspec svg created with inkscapeself-published work
US Navy 081001-N-9134V-025 Seaman Ashley Gonzalez administers a purified protein derivative shot to Chief Quartermaster Melvin Prescott
aboard uss carter hall (lsd-50)
US Navy 110524-N-ZB612-026 Chief of Naval Operations (CNO) Adm. Gary Roughead reenlists seven Sailors during an all-hands call
people at naval station rota
US Navy 101109-N-4236E-059 Ellen Roughead, wife of Chief of Naval Operations (CNO) Adm. Gary Roughead, speaks with military spouses during a Spouse
naval station norfolk
US Navy 120123-N-YQ566-049 Chief of Naval Operations (CNO) Adm. Jonathan Greenert delivers remarks and answers questions at the San Diego Military
military in san diegocalifornia
US Navy 110907-N-ER662-254 Senior enlisted leaders participate in a 5K pride run with the chief selects at Fleet Activities Yokosuka
united states navy images from yokosuka
US Navy 100120-N-8273J-084 Chief of Naval Operations (CNO) Adm. Gary Roughead answers questions while speaking with media
santa barbaracalifornia
US Navy 081126-N-3289C-087 Battalion Chief Christopher Hubmer looks out the window after conducting a burn exercise
naval station rotapeople
US Navy 100916-N-0475R-137 Chief Equipment Operator Thomas Colesanti, center, assigned to the Naval Mobile Construction Battalion (NMCB) 5, has his
camp leatherneckpeople
USS John C. Stennis Chief selectees clean Retsil Veterans Home 160901-N-EC099-035
uss john c. stennis (cvn-74)group
Master Chief Petty Officer of the Navy in Virginia 090417-N-4515N-008
naval air station oceanajr
US Navy 110703-N-DB801-147 Chief Personnel Specialist Robbie Smith mans the rails aboard USS Blue Ridge (LCC 19)
uss blue ridge (lcc-19)
US Navy 111103-N-YM590-019 Chief Cryptologic Technician (Technical) Terry Draper, center, stands watch as the surface warfare coordinator in the Co
uss anzio (cg-68)lowlight
US Navy 110510-N-WP746-257 Master Chief Master-at-Arms Melvin Lewis, assigned to U.S. Pacific Fleet, performs a flag passing ceremony
people at battleship missouri memorial
US Navy 110531-N-UK333-167 Chief Electronics Technician Daniel Villarreal is greeted by his wife as he is the first to disembark the Los Angeles-cl
uss charlotte (ssn-766)
191106-D-SW162-1350 (49025966648)
landscapegrassland
191106-D-SW162-1375 (49025965958)
landscapevehicle
CJCS meets with Albanian President (37242130595)
images from the chairman of the joint chiefs of staff flickr streamjr
CJCS meets with Albanian President (37051736916)
images from the chairman of the joint chiefs of staff flickr streamjr
160720-N-NM917-016 160720-N-NM917-016
uss blue ridge (lcc-19)uss mustin (ddg-89)
160720-N-NM917-020 160720-N-NM917-020
uss blue ridge (lcc-19)uss mustin (ddg-89)
181223-D-PB383-019 (46435198781)
images from the chairman of the joint chiefs of staff flickr streamuss john c. stennis (cvn-74)
7601 - 7700 of 17,896 Next page
/ 179