25,167 Free Images of Death

lithographs by josef kriehuberlithographs by eduard kaisercemeterylandscapegravedead1870 deathslithographs by august prinzhoferlithographs by adolf dauthage1891 deaths
Franz Unger Hoffmann Litho
lithographs by rudolf hoffmann1800 births
Franz Morelly Litho
male composers from austria1859 deaths
Franz Schweighofer Litho
male painters from austria1861 deaths
Franz Xaver Kuttnar Litho
lithographs by august prinzhofer1846 deaths
Friedrich Hebbel Litho 02
poets from germany1813 births
Viktor Herzenskron Litho
male writers from germany1897 deaths
Florian Robert Dauthage Litho
lithographs by adolf dauthage1794 births
Friedrich Hebbel Litho 01
lithographs by josef kriehuber1813 births
Hans Baldung - Three Ages of the Woman and the Death - WGA01189
1510 paintings1510 in art
Francisco de Mendoza
17th-century engravings in the biblioteca nacional de españaadmirals of spain
Giotto di Bondone 054
stigmatatonsure
Cagnacci, Guido - Cleopatra - Google Art Project
17th-century paintings of the death of cleopatrapaintings of nude women by guido cagnacci
Carl Justin Sonderegger 1893
members of the swiss national council1842 births
Cappella brancacci, Distribuzione delle elemosine e la morte di Anania (restaurato), Masaccio
the distribution of alms and death of ananias
Lilien Pharao
religious themes by ephraim moshe liliententh plague of egypt (firstborn death)
Luise Harriers Litho
soprano opera vocalists1836 births
Mahmud II Litho
lithographs of royalty by josef kriehuberlithographs by josef kriehuber
Leonhard Nowey Litho
lithographs by josef kriehuberofficers from austria
Lepecq-de-la-cloture
1736 births1804 deaths
Leopold Latour-Thurmberg Litho
lithographs by josef kriehuber1794 births
Leopold von Rauch Litho
generals of prussia1860 deaths
Ludwig Loewe Decker Litho
male actors from germanyburgtheater
Ludwig von Welden Litho
lithographs by josef kriehubergenerals of austria
Masquerades and Operas
culture of englandpeople in london
Moritz von Braida Litho
lithographs by josef kriehubergenerals of austria
Manuel Rodriguez - por Luis Fernando Rojas
luis fernando rojas1786 births
Mihaly Zichy-Portrait James Wylie 1768-1854
1768 birthsportrait
Independencia brasil 001
independence of brazilindependence
Ignaz Schlegl Litho
lithographs of people of vienna1794 births
Jan van Leiden Litho
lithographs by adolph friedrich kunikejan van leiden
Jan Vilímek - Petr Miloslav Veselský
portraits by jan vilímekhumoristické listy
James Heath - The Death of Major Peirson - Google Art Project
prints in the museum of fine artshouston
John of Leiden
lithographs by adolph friedrich kunikejan van leiden
Johann Sina Litho
lithographs by friedrich lieder1804 births
Joseph Cinquez, the brave Congolese Chief, who prefers death to slavery, and who now lies in jail ... LCCN2003690782
joseph cinqué
Johann Georg Walcher Litho
lithographs by josef kriehuberofficials of austria
Karl Czak Litho
lithographs by josef kriehuberdíszmagyar
Karoline Pichler Litho
female writers from austria1843 deaths
Karl Stern Litho
lithographs by josef kriehuberschottenstift
Karl Weis Litho
lithographs by josef kriehubermale writers from austria
Karoline von Josch Litho
people of carinthia1806 births
Keya Takehisa
people of fukuoka domain1628 deaths
Hori Sadanori
twenty-four riders of kurodapeople of fukuoka domain
Jacek Malczewski - Artist's death - MP 1215 - National Museum in Warsaw
paintings in the national museum in warsawpaintings by jacek malczewski
Józef Ryszkiewicz - Death of a vivandiere - MP 4868 - National Museum in Warsaw
paintings in the national museum in warsawjózef ryszkiewicz (father)
Hugo Simberg - Piru muuttaa - A IV 3678 - Finnish National Gallery
death and devils by hugo simbergfinnish national gallery
Hugo Simberg - Examination - A II 968-26 - Finnish National Gallery
death and devils by hugo simbergfinnish national gallery
Peter Franz Bibus Litho
jurists from austria1825 births
Omer Pascha Latas Litho
lithographs by adolf dauthage1806 births
Anna Millerschek Litho
lithographs by adolf dauthage1899 deaths
Prince Naohito
people of edo period1704 births
Piero della Francesca - Mort d'Adam
details of italian frescosnude males in frescos
P409 George II. Receiving from Walpole Intelligence of his Father's Death
cassell's illustrated history of england vol 4
Noël Hallé - The Death of Seneca - 1978.123 - Museum of Fine Arts
noël halléboston
Charlotte Wolter Litho
actresses from austriaburgtheater
Edmund Götz Litho
schottenstift1852 deaths
Eduard Breier Litho
male writers from austria1886 deaths
Eduard Lumpe Litho II
men of austria1813 births
Eduard Warrens Litho
lithographs by josef kriehubermen of austria
Eduard von Clam-Gallas
lithographs by josef kriehubergenerals of austria
Edvard Munch - The Death of the Bohemian - MM.M.00175 - Munch Museum
paintings by edvard munch in the munchmuseetworks by edvard munch in the munchmuseet
Bourgogne, Yolande de (Recueil d'Arras, f. 108)
recueil d’arrashouse of valois
Georg Orsich-Slavfatic Litho
nobility of croatia1847 deaths
Emanuel Andrassy Litho
1891 deathsdíszmagyar
Geremia Bettini Litho
male vocalists from italy1823 births
Johann 'Waldstätten Litho
generals of austria1833 births
Simon Hirsch Litho
lithographs by josef kriehubermedical officer
Vincenz Augustin Litho
1780 births1859 deaths
Weittenhiller Litho
lithographs by josef kriehuber1861 deaths
Takatsukasa Kanehira
takatsukasa familykonoe family
Stefan sen. Zichy Litho
lithographs by josef kriehuberzichy family
Stephan Steiger Litho
lithographs by josef kriehuberportraits of men
Skull
skullbone
Illustration plants Free illustrations
illustrationskull
Sultan beggars humor
skeletonbone
Kuntze Death of Priam
1750s paintings in polanddeath in paintings
Death spooky dead
landscapetree
Spiral modern grave
landscapemountain
Bruges halloween day of the dead
day of the deadcelebrities
Love romantic romance
weddingsea
Gravestone tombstone mausoleum
landscapenature
Religion live die
watersea
Weird skull and crossbones dead
skeletonskull
Christ cross christian
christianitydeath
Holiday folklore muertos
celebritiesmexico
Fairground year market creepy
creepydeath
Mystery ghost spirituality
animalsghost
Endangered fish devil's hole pupfish pupfish
landscapewater
Desert salt tree
backgroundlandscape
Dark halloween dead
day of the deadmexico
Graveyard christianity religious
religiousstones
Christianity memorial mourning
deathwar
Scenic mountains california
landscapenature
Mausoleum rock carving art
greentree
Шурыгин
self-published workcc-zero
Gravestone of Shahr Banu Tallaei (1921 - 1956 ) - Khorombak cemetery - Nishapur
self-published work1921 births
OahuCemetery-CaptJamesKing-tombstone
self-published work1833 births
Death of Becket, wall painting, St James, Bramley 02
self-published workcc-zero
Mariano Fernández Echeverría y Veytia
men facing left in art1780 deaths
Friedrich Schiller, German Poet and Surgeon 100th Death Anniversary Medal Karlsruhe 1905 ND, reverse
friedrich schiller1905
3901 - 4000 of 25,167 Next page
/ 252