23,343 Free Images of Demonstration

cc-zerophotographs by leonhard lenzcitytrafficpavementsidewalkcity lifedemonstration from at willy-brandt-haus to invalidenpark berlin 2020-07-01lightfife years paris agreement bicycle demonstration berlin 2020-12-12
Demonstration from at Willy-Brandt-Haus to Invalidenpark Berlin 2020-07-01 03
self-published workcc-zero
Demonstration from at Willy-Brandt-Haus to Invalidenpark Berlin 2020-07-01 33
self-published workcc-zero
Demonstration against Erdogan during Libya conference Berlin 2020-01-19 16
self-published workcc-zero
İstiklal Caddesi Kadın Yürüyüşü 2021
architecturecity
Women react to tear gas - protest at Al-Azhar University Cairo 11-Dec-2013
demonstrations and protests in egypt in 20132013 coup d'état in egypt
A100stoppen bicycle demonstration Berlin 2021-05-24 229
vehiclecar
A100stoppen bicycle demonstration Berlin 2021-05-24 233
peoplecity
A100stoppen bicycle demonstration Berlin 2021-05-24 221
peoplecity
Antifascist bicycle demonstration Berlin 2021-03-28 16
peoplecity
A100stoppen bicycle demonstration Berlin 2021-04-10 127
peoplecity
A100stoppen bicycle demonstration Berlin 2021-04-10 124
peoplecity
A100stoppen bicycle demonstration Berlin 2021-05-24 94
trafficcity
A100stoppen bicycle demonstration Berlin 2021-04-10 52
trafficcity
Article13 demonstration Berlin 104
self-published workcity
Bicycle demonstration against A49 and A100 in Berlin 2020-11-14 42
trafficpeople
Bicycle demonstration against A49 and A100 in Berlin 2020-11-14 37
trafficcity
Bicycle demonstration against A49 and A100 in Berlin 2020-11-14 53
peoplecity
Bicycle demonstration against A49 and A100 in Berlin 2020-11-14 98
self-published workvehicle
Bicycle demonstration against A49 and A100 in Berlin 2020-11-28 116
pavementtraffic
Bicycle demonstration against A49 and A100 in Berlin 2020-11-14 70
sidewalkpavement
Bicycle demonstration against A49 and A100 in Berlin 2020-11-28 24
self-published workcity life
Bicycle demonstration against A49 and A100 in Berlin 2020-11-28 119
celebritiesgroup
Bicycle demonstration against A49 and A100 in Berlin 2020-11-28 01
peoplecity
Bicycle demonstration against A49 and A100 in Berlin 2020-11-14 79
peoplecity
Bicycle demonstration against A49 and A100 in Berlin 2020-11-28 85
nighttimelight
Bicycle demonstration against A49 and A100 in Berlin 2020-11-28 72
nighttimelight
Bicycle demonstration against A49 and A100 in Berlin 2020-11-28 63
nighttimelight
Bicycle demonstration against A49 and A100 in Berlin 2020-11-14 20
self-published workvehicle
Bicycle demonstration against A49 and A100 in Berlin 2020-11-28 146
peoplecity
Coal and Boat Demonstration Berlin May 2018 26
self-published workpages with maps
Coal and Boat Demonstration Berlin May 2018 15
travel photographyboat
Conspiracist demonstration Berlin 2020-11-18 120
officerpeople
Demonstration at Platz der Republik at Rebellion Week Berlin 2019-10-09 40
self-published workcc-zero
Demonstration at Platz der Republik at Rebellion Week Berlin 2019-10-09 38
self-published workcc-zero
Demonstration at Platz der Republik at Rebellion Week Berlin 2019-10-09 21
self-published workcc-zero
Demonstration from at Willy-Brandt-Haus to Invalidenpark Berlin 2020-07-01 58
self-published workcc-zero
Demonstration at Platz der Republik at Rebellion Week Berlin 2019-10-09 23
self-published workcc-zero
Demonstration from at Willy-Brandt-Haus to Invalidenpark Berlin 2020-07-01 27
self-published workcc-zero
Demonstration at Platz der Republik at Rebellion Week Berlin 2019-10-09 36
self-published workcc-zero
Demonstration from at Willy-Brandt-Haus to Invalidenpark Berlin 2020-07-01 68
self-published workcc-zero
Demonstration from at Willy-Brandt-Haus to Invalidenpark Berlin 2020-07-01 65
self-published workcc-zero
Demonstration at Platz der Republik at Rebellion Week Berlin 2019-10-09 39
self-published workcc-zero
Demonstration from at Willy-Brandt-Haus to Invalidenpark Berlin 2020-07-01 05
self-published workcc-zero
Demonstration from at Willy-Brandt-Haus to Invalidenpark Berlin 2020-07-01 63
self-published workcc-zero
Demostration in Venezuela, Margarita Isla
celebritiespeople
Demonstration-Protest in Mexico City, May 1, 1989-19
creative commons cc0 1.0 universal public domain dedication with different sdc copyright licensecc-zero
Demonstration from at Willy-Brandt-Haus to Invalidenpark Berlin 2020-07-01 04
self-published workcc-zero
Day X Syndikat eviction demonstration Berlin 2020-08-07 15
groupnight
Day X Syndikat eviction demonstration Berlin 2020-08-07 04
lightnight
Day X Syndikat eviction demonstration Berlin 2020-08-07 50
architecturelight
Day X Syndikat eviction demonstration Berlin 2020-08-07 14
lightnight
Demonstration against Erdogan during Libya conference Berlin 2020-01-19 02
self-published workcc-zero
Demonstration against Erdogan during Libya conference Berlin 2020-01-19 04
self-published workcc-zero
Demonstration against Erdogan during Libya conference Berlin 2020-01-19 05
self-published workcc-zero
Demonstration against Erdogan during Libya conference Berlin 2020-01-19 09
self-published workcc-zero
Demonstration against Erdogan during Libya conference Berlin 2020-01-19 14
self-published workcc-zero
Dannibleibt bicycle demonstration Berlin 2020-11-21 123
lightdark
Dannibleibt bicycle demonstration Berlin 2020-11-21 15
peoplecity
Dannibleibt bicycle demonstration Berlin 2020-11-21 113
trafficcity
Conspiracist demonstration Berlin 2020-11-18 145
pavementpeople
Europe dont kill demonstration Berlin 2020-03-07 77
sidewalkpavement
FCK2020 demonstration Berlin 2020-12-30 48
cityscapecity
Hedonist International bicycle demonstration at Rebellion Week Berlin 2019-10-07 23
self-published workcc-zero
Fife years Paris agreement bicycle demonstration Berlin 2020-12-12 183
self-published workcc-zero
Global Climate Strike Berlin bicycle demonstration Treptow 2021-03-19 172
self-published workcc-zero
Global Climate Strike Berlin bicycle demonstration Treptow 2021-03-19 111
self-published workcc-zero
Global Climate Strike Berlin bicycle demonstration Treptow 2021-03-19 110
self-published workcc-zero
Global Climate Strike Berlin bicycle demonstration Steglitz 2021-03-19 108
self-published workcc-zero
Global Climate Strike Berlin bicycle demonstration Steglitz 2021-03-19 06
self-published workcc-zero
Global Climate Strike Berlin bicycle demonstration Steglitz 2021-03-19 11
self-published workcc-zero
Global Climate Strike Berlin bicycle demonstration Treptow 2021-03-19 04
self-published workcc-zero
Global Climate Strike Berlin bicycle demonstration Steglitz 2021-03-19 122
self-published workcc-zero
Global Climate Strike Berlin bicycle demonstration Treptow 2021-03-19 11
self-published workcc-zero
Global Climate Strike Berlin bicycle demonstration Steglitz 2021-03-19 10
self-published workcc-zero
Global Climate Strike Berlin bicycle demonstration Treptow 2021-03-19 31
self-published workcc-zero
Global Climate Strike Berlin bicycle demonstration Treptow 2021-03-19 19
self-published workcc-zero
Global Climate Strike Berlin bicycle demonstration Treptow 2021-03-19 24
self-published workcc-zero
Global Climate Strike Berlin bicycle demonstration Steglitz 2021-03-19 13
self-published workcc-zero
Global Climate Strike Berlin bicycle demonstration Steglitz 2021-03-19 51
self-published workcc-zero
MyGruni 1st may demonstration Berlin 2021 Großer Stern to Grunewald 61
peoplecity
MyGruni 1st may demonstration Berlin 2021 Großer Stern to Grunewald 68
peoplecity
Mietendeckel demonstration Berlin 2021-04-15 67
peoplecity
Mietendeckel demonstration Berlin 2021-04-15 68
peoplecity
Mietendeckel demonstration Berlin 2021-04-15 43
vehiclecity
Mietenwahnsinn demonstration Berlin 2020-06-20 60
peoplecity
Nichtmituns to Wir haben Platz demonstration Berlin 2020-02-08 16
architecturecity
Nichtmituns to Wir haben Platz demonstration Berlin 2020-02-08 14
peoplecity
Nichtmituns to Wir haben Platz demonstration Berlin 2020-02-08 21
citytown
Iranska flyktingars riksförbund at demonstration against Swedish migration policy in Stockholm
city lifepeople
Ihr seid keine Sicherheit demonstration 2021-05-08 99
vehiclecar
Police at demonstration of Wir für Deutschland 2019-10-03 03
vehiclecar
Placard against Swedish Green Party at demonstration against Swedish migration policy in Stockholm
self-published workpages with maps
Fife years Paris agreement bicycle demonstration Berlin 2020-12-12 02
self-published workcc-zero
Fife years Paris agreement bicycle demonstration Berlin 2020-12-12 07
self-published workcc-zero
Fife years Paris agreement bicycle demonstration Berlin 2020-12-12 45
self-published workcc-zero
Fife years Paris agreement bicycle demonstration Berlin 2020-12-12 84
self-published workcc-zero
Fife years Paris agreement bicycle demonstration Berlin 2020-12-12 142
self-published workcc-zero
Fife years Paris agreement bicycle demonstration Berlin 2020-12-12 41
self-published workcc-zero
Fife years Paris agreement bicycle demonstration Berlin 2020-12-12 88
self-published workcc-zero
Fife years Paris agreement bicycle demonstration Berlin 2020-12-12 85
self-published workcc-zero
9201 - 9300 of 23,343 Next page
/ 234