48,392 Free Images of Fire

cc-zeropages with mapsvehicleplantsflamedarkaviation boatswain's matemilitaryexplosionarchitecture
US Navy 040309-N-5319A-005 A fire fighting hose team advances on an EA-6B Prowler assigned to the Patriots of Electronic Attack Squadron One Four Zero (VAQ-140)
electronic attack squadron 140 (united states navy)grumman ea-6 prowler
U.S. Navy Chief Aviation Boatswain's Mate (Handling) Shawn Riley, center right, instructs Sailors on proper fire hose handling techniques June 27, 2014, during a general quarters drill on the flight deck of 140627-N-CZ979-049
wavesea
U.S. Navy Electronics Technician 3rd Class Dillon Fair, assigned to the amphibious transport dock ship USS Denver (LPD 9), loads ammunition into an M240B machine gun before a live-fire exercise March 10, 2014 140310-N-ZU025-009
aboard uss denver (lpd-9)m-240 machine gun
U.S. Navy Mass Communication Specialist 3rd Class Andrew Gordon, left, films Sailors as they learn proper fire hose handling techniques June 27, 2014, during a general quarters drill on the flight deck of 140627-N-CZ979-042
waterfrontsea
U.S. Sailors fight a simulated fire during a general quarters drill in the hangar bay of the aircraft carrier USS Harry S. Truman (CVN 75) March 8, 2014, in the Gulf of Oman 140308-N-ZG705-530
uss harry s. truman (cvn-75)operation enduring freedom
US Navy 110921-N-XQ375-483 Operations Specialist 1st Class Neil Belton fires an M16 rifle during a weapons qualification exercise aboard USS Mitsch
m16 and stanag magazinesmales with m16 rifle
Stunning photos of a buck at sunset in eastern Oregon were captured not far from where the Dry Gulch Fire burned during the 2015 wildfire season. The photos were captured in early December, 2015, by S
animalsmammals
San Roque, Cardona, Rizal Patunhay, Cardona, Rizal Cardona Multi-Purpose Cooperative - Shared Service Facility DOST Water hyacynth Yanmar Caterpillar E110B Cardona Public Market Cardona Fire Station a
eichhornia crassipesplants
San Roque, Cardona, Rizal Patunhay, Cardona, Rizal Cardona Multi-Purpose Cooperative - Shared Service Facility DOST Water hyacynth Yanmar Caterpillar E110B Cardona Public Market Cardona Fire Station a
eichhornia crassipesplants
San Roque, Cardona, Rizal Patunhay, Cardona, Rizal Cardona Multi-Purpose Cooperative - Shared Service Facility DOST Water hyacynth Yanmar Caterpillar E110B Cardona Public Market Cardona Fire Station a
eichhornia crassipesplants
Purpurstieliges Hornzahnmoos (Ceratodon purpureus) auf einer Brachfläche der Halberger Hütte in Brebach
redshankplants
US Navy 061104-N-3729H-121 Aviation Boatswain's Mate 1st Class Michael Feliciano waves red and black flags to represent a fire during a general quarters drill in the hangar bay of nuclear-powered aircraft carrier USS John C. St
aboard uss john c. stennis (cvn-74)aviation boatswain's mate
US Navy 071023-N-3069F-029 A civilian helicopter refills a bucket used to drop water in coordination with fire fighters and Navy pilots assigned to Helicopter Sea Combat Squadron (HSC) 85
helicopter sea combat squadron 85 (united states navy)helicopter bucket
US Navy 071024-N-2638R-007 Sailors assigned to the submarine tender USS Frank Cable (AS 40), prepare their self-contained breathing apparatuses (SCBA) during an advanced shipboard fire fighting class at the Center for Naval Eng
self-contained breathing apparatus (firefighting)aboard uss frank cable (as-40)
US Navy 090810-N-4124C-004 Gunners Mate 1st Class Todd Waldon and Fire Controllman 2nd Class Michael Sprague, both assigned to the guided-missile cruiser USS Normandy (CG 60), load a .50 caliber machine gun
browning m2 in united states navy serviceaboard uss normandy (cg-60)
US Navy 071110-N-7883G-040 Chief Machinery Repairman Tim Groeneveld, right, gives instructions to Damage Controlman 3rd Class Jonathan Rios during a main machinery space fire drill aboard the aircraft carrier USS Kitty Hawk (CV
aboard uss kitty hawk (cv-63)people
US Navy 090326-N-0000X-001 The San Diego-based guided-missile destroyer USS Benfold (DDG 65) fires a missile Thursday, March 26, 2009 during training exercise Stellar Daggers in the Pacific Ocean
launches of rim-66 standard mr missilesuss benfold
US Navy 070315-N-2659P-127 Aviation Boatswain's Mate Airman Recruit Billy Crook stands ready to respond to any fire or emergency that might arise as part of the crash and salvage team aboard Nimitz-class aircraft carrier USS Jo
aviation boatswain's matemilitary
Grandmother's story, Pietro Saltini, 1875
1875 oil on canvas paintingspurism,realism
Incendie du moulin, Édouard Daliphard, novembre1869
ancien pont de poissy in artfire in art
Man model art
sculpturemale
Usa stairs downtown
buildingskyline
Holiday celebration party
4th of july celebrities
Lamps candle candle light
celebritieschristmas
Ascend aviation ball
travelball
Branch landscape the environment
landscapetree
Rumpenheimer Schlossgasse 1-7, Marstall
architecturetown
Firehouse Tompkins Hylan jeh
sidewalkpavement
Giovanni Battista Piranesi - Le Carceri d'Invenzione - Second Edition - 1761 - 06 - The Smoking Fire - Museum Berggruen - DSC03792
self-published workcc-pd-mark
2014년 10월 14일 소방공무원 박태민, 김춘종, 홍성림, 최순복, 한기술, 석상하, 표형근
self-published workcc-zero
2015년 1월 20일 서초소방서장 권혁민 방배119안전센터 초도 순시71
self-published workcc-zero
NYPL Murray St BPC evacuation drill jeh
cityscapecity
Holzhaufen für das Sonnwenfeuer 2019 auf der Salzwiese in Tübingen
self-published workfire
Kiefersfelden — Saugstelle
pages with mapsarchitecture
Flickr - Official U.S. Navy Imagery - A jet fires its afterburners before launching from the flight deck.
aircraftvehicle
F-14A VF-84 over burning Kuwaiti oil wells 1991
aerial photographs of f-14 tomcat in flightclouds
US Navy 040322-N-2060K-002 Sailors from the Pascagoula, Miss.-based Aegis guided-missile cruiser USS Yorktown (CG 48) fight a fire aboard motor vessel Everton off the coast of Oman
boatship
U.S. Navy Construction Mechanic 2nd Class Brent Rensink, foreground, with Naval Mobile Construction Battalion (NMCB) 25, fires an M4 carbine during Naval Construction Group 2's M4-M16 qualification course 140211-N-JP566-113
operation enduring freedommales with m4 carbine
US Navy 060702-N-4776G-501 An HH-60H Seahawk assigned to Helicopter Anti-Submarine Warfare Squadron Four (HS-4), fires flairs during an air demonstration
aircraftvehicle
US Navy 060317-N-9389D-078 Gunner's Mate 1st Class Walton Ciferri assigned to USS Kitty Hawk (CV 63) directs a Sailor to fire at a target during a gun qualification at the Commander, Fleet Activities Yokosuka (CFAY) gun range
yokosuka naval base in the 2000saboard uss kitty hawk (cv-63)
US Navy 070320-N-7981E-374 Aviation Boatswain's Mate (Handling) 1st Class Alton Keith leads two hose teams into a simulated fire during a general quarters drill
aviation boatswain's matepeople
US Navy 070504-N-7883G-048 Engineering and air department Sailors observe tests of the aqueous film forming foam (AFFF) fire suppression system in hangar bay 1 on USS Kitty Hawk (CV 63)
wintersnow
US Navy 080811-N-4205W-005 Special Warfare Combatant-craft Crewmen assigned to Special Boat Team 22 (SBT-22) conduct live-fire immediate action drills
vehiclefall
US Navy 080811-N-4205W-023 Special Warfare Combatant-craft Crewmen assigned to Special Boat Team 22 (SBT-22) conduct live-fire immediate action drills
vehiclewater
USS Columbia (CL-56) shelling Japanese facilities in the Shortlands on 1 November 1943
monochromedark
US Navy 081107-N-0411D-012 Mass Communication Specialist 2nd Class Laura Moore fires an M4 rifle during quarterly training for Naval Expeditionary Combat Command Detachment Combat Camera, Norfolk
fort pickettmilitary
US Navy 090226-N-7090S-115 An improvised explosive device (IED) is detonated during a live-fire demonstration at Indian Head, Md. IEDs are one of the primary causes of casualties in Iraq and Afghanistan
explosionmaryland
US Navy 090324-N-7730P-092 Aviation Boatswain's Mate (Handling) 3rd Class Tilford Breedlove-Green mans a fire hose during a flight deck scrub down aboard the aircraft carrier USS Ronald Reagan (CVN 76)
flight deck maintenance aboard uss ronald reagan (cvn-76)aviation boatswain's mate
US Navy 110623-N-PM781-002 Sailors assigned to Maritime Expeditionary Security Squadron (MSRON) 1 conduct a live-fire exercise at San Clemente Isl
landscapesea
US Navy 101221-N-9643K-440 A NASSCO shipyard worker stands fire watch as work continues beneath the hull of the amphibious assault ship USS Bonhomm
lightdark
US Navy 090925-N-3038W-126 Aviation Ordnanceman Airman Recruit Janelle Ray prepares .50 cal. ammunition belts before a live-fire exercise aboard the aircraft carrier USS Nimitz (CVN 68)
.50 bmg ammunition beltsaviation ordnanceman
US Navy 091112-N-1062H-023 Mass Communication Specialist Seaman Apprentice Marcos Vazquez mans a hose at the primary fire boundary during a general quarters drill aboard the aircraft carrier USS George Washington (CVN 73)
mass communication specialistanti-flash gear
US Navy 090421-N-3830J-180 Lt. j.g. Jeffery Hanson, damage control assistant aboard the amphibious command ship USS Blue Ridge (LCC 19), demonstrates proper hose handling techniques to the flight deck fire party
peopledark
US Navy 090722-N-1062H-012 Aviation Boatswain's Mate (Handling) 3rd Class Rafael Caba fakes out a fire hose during a general quarters drill aboard the aircraft carrier USS George Washington (CVN 73)
aviation boatswain's matetalisman sabre 2009
US Navy 090912-N-0413R-171 A Sailor assigned to the amphibious transport dock ship USS New York (LPD 21) tours the fire station of Engine 8, Ladder 2, 8th Battalion in New York City
military in new york citypeople
US Navy 090618-N-6720T-082 Sailors assigned to the air department aboard the aircraft carrier USS George Washington (CVN 73) simulate fighting an aircraft fire during a general quarters drill
grouparmy
US Navy 090713-N-2638R-003 Boatswain's Mate 3rd Class Michael Umayam, from McLean, Va., passes a message back to the next Sailor in his hose team during fire fighting training aboard the guided-missile destroyer USS Mustin (DDG
aboard uss mustin (ddg-89)talisman sabre 2009
US Navy 080131-N-8273J-119 Adm. Gary Roughead Chief of Naval Operations (CNO) speaks during the electromagnetic (EM) railgun live-fire demonstration at Naval Surface Warfare Center (NSWC) Dahlgren
naval surface warfare center dahlgren divisionunited states navy images from virginia
US Navy 080130-N-7981E-036 A member of a hose team calls for personnel to relieve his team while fighting a simulated fire during a general quarters drill aboard the Nimitz-class aircraft carrier USS Abraham Lincoln (CVN 72)
watertight doorpointing right
US Navy 100220-N-7058E-309 Chief Gunners Mate Joshua Gordon, assigned to the littoral combat ship USS Freedom (LCS 1) fires a shot line to the Military Sealift Command fleet replenishment oiler USNS Leroy Grumman
militarynavy
US Navy 100123-N-2475A-214 The honor guard fires a rifle volley during a burial at sea ceremony aboard the Nimitz-class aircraft carrier USS John C. Stennis (CVN 74)
three-volley salutetraffic
US Navy 100309-N-7498L-001 Gas Turbine System Mechanic Fireman Justin Munger, left, and Fire Controlman 2nd Class Justin Wong gather leaves and debris during the Joint Base Pearl Harbor-Hickam installation-wide base cleanup
united states navy images from pearl harbor2010 in pearl harbor
US Navy 100310-N-7058E-201 Fire Controlman 1st Class Ronila Ivory uses inert ammunition to demonstrate how to load an M240 machine gun during crew-served weapons familiarization training aboard the littoral combat ship USS Free
aboard uss freedom (lcs-1)m-240 machine gun
US Navy 100419-N-6138K-711 Spanish navy sailors aboard the Spanish navy Servola-class offshore patrol vessel SPS Centinela (P 72), demonstrate how to combat a flight deck fire
vesselship
US Navy 100427-N-7280V-269 Yeoman 3rd Class Jacob Slay, center, fires a twin .50-caliber machine gun as Information Systems Technician 2nd Class Michael Ervin, left, and Gunner's Mate 2nd Class Joshua Pacheco
aboard uss blue ridge (lcc-19)yeoman (united states navy)
US Navy 070119-N-0696M-429 Chief of Naval Operations (CNO) Adm. Mike Mullen watches as Army drill sergeants fire weapons at the Battle Simulation Center at Ft. Jackson
nightdark
US Navy 070210-N-4649C-096 Chief Damage Controlman Enrique Jograj reviews the contents of a gas free kit to Engineman 2nd Class Jason Garcia during a main space fire drill aboard Arleigh Burke-class guided missile destroyer USS
damage controlmanpeople
US Navy 100610-N-8283S-046 A rifle squad from the amphibious assault ship USS Boxer (LHD 4) fire a 21-gun salute during a burial at sea
aboard uss boxer (lhd-4)males with m16 rifle
Bold Alligator 2014 141027-N-YD328-255
eotech holographic sightsmolle armor carriers
Chestnut blight. Experimental trials of resistant Castanea dentata by the American Chestnut Foundation at Tower Hill Botanic Garden, Boylston, Massachusetts, USA.
foresttree
US Navy 061108-N-6999H-033 Senior Chief Explosive Ordnance Technician Michael G. Manning, an instructor at the new naval firing range attached to Explosive Ordnance Disposal Training and Evaluation Unit One (EODTEU-1), simulate
naval air weapons station china lakemountain
US Navy 071016-N-7981E-092 Members of air department stand fire watch in the hangar bay of Nimitz-class aircraft carrier USS Abraham Lincoln (CVN 72) during an ordnance onload at Naval Magazine Indian Island
munitions management aboard uss abraham lincoln (cvn-72)naval magazine indian island
US Navy 071023-N-4776G-013 The sun rises through the smoke from the Harris Wildfires as seen from on board USS Ronald Reagan (CVN 76)
sunsetsun
US Navy 090623-N-6720T-048 Seaman William Current, assigned to the Operations department, security division, aboard the aircraft carrier USS George Washington (CVN 73), fires an M-240B machine gun
militarynavy
US Navy 100926-N-7680E-410 Gunner's Mate 3rd Class Andrey Murry, from Hickory, N.C., fires a grenade from an M203 grenade launcher during a live-fi
gunner's mateshoot
US Navy 111013-N-XQ375-469 A MK-38 25mm machine gun fires during a weapons exercise aboard the guided-missile destroyer USS Mitscher (DDG 57)
militaryvehicle
Stunning photos of a buck at sunset in eastern Oregon were captured not far from where the Dry Gulch Fire burned during the 2015 wildfire season. The photos were captured in early December, 2015, by S
animalsmammals
Coat of arms of the city of Bayamo
phrygian caps in heraldryself-published work
The Fires of Revolution: A Roumanian Frontier Guard Watching the Burning of Russian Villages across the Pruth, Hermanus Willem Koekkoek, 13 January 1906
the illustrated london news 1906hermanus willem koekkoek
Christmas motif christmas tree greeting card
christmasmaps
Campfire
firewood
Commune de Paris nuit du 23 au 24 mai incendies dans Paris, Auguste Victor Deroy, after 1871
destructions during the paris communebird's-eye views of paris
The Great Fire of Hamburg in 1842
historic views of hamburg by suhr brothersgreat fire of hamburg, 1842
Fire in the Evening, Paul Klee, 1929
expressionism,surrealism,pointillism,bauhaus,color fieldpaintings by paul klee in the museum of modern art
Fire engine T333 at Front Street
self-published workvehicle
The Trial by Fire (Saint Dominic and the Albigensians), Pedro Berruguete
paintings of saint dominic in spainrenaissance
Fire in Ljubljana in 1887, Ludvik Grilc
19th-century images of congress square1887 in ljubljana
Jungfernstieg und Binnenalster 1842
great fire of hamburg, 1842jungfernstieg
The Fire of the Düsseldorf Castle, August von Wille, 1872
fire in paintingsaugust von wille
Lot and his daughters, Hans Rottenhammer, circa 1597
paintings by jan brueghel (i) in the alte pinakotheknorthern mannerism
Elijah Taken Up in a Chariot of Fire, Giuseppe Angeli, circa 1740
giuseppe angelibaroque
Shadow statue blood
naturespace
Model art sculpture
sculpturemale
Jagged small leaf acer tataricum subsp ginnala
greenleaf
Brand wax ease
backgroundchristmas
Special train special crossing nostalgia
vehicleworm
Fielder opponents football pitch
soccerball
Background texture fried
backgroundfood
Rupt-aux-Nonains (Meuse) sapeurs-pompiers
self-published workpages with maps
Moscow, Paveletskaya Embankment, parked fireboats August 2012 04
waterfrontboat
22001 - 22100 of 48,392 Next page
/ 484