6,422 Free Images of Hawk

vehiclenavyshipaircraftmilitarysh-60f seahawkaboard uss kitty hawk (cv-63)aboard uss nimitz (cvn-68)flyhelicopter sea combat squadron 9 (united states navy)
US Army helicopters on USS Eisenhower (CVN-69) off Haiti in 1994
ah-1 cobravehicle
An MH-60S Sea Hawk helicopter picks up cargo from the flight deck of USNS Leroy Grumman. (29206264772)
vehiclenavy
I am the originator of this photo. I hold the copyright. I release it to the public domain. This photo depicts a flower.
natureplants
US Navy 070329-N-8591H-134 Alex Trebek of the trivia game show Jeopardy^ along with USO members and the Jeopardy film crew receive a brief about USS Kitty Hawk's (CV 63) capabilities
yokosuka naval base in the 2000saboard uss kitty hawk (cv-63)
US Navy 070406-N-0555B-037 Aviation ordnancemen attach a sling to an HH-60H Seahawk, assigned to the Black Knights of Helicopter Anti-Submarine Squadron (HS) 4
photographic silhouettes of menaviation ordnanceman
US Navy 070126-N-6106R-031 Aviation Boatswain's Mate (Handling) Airman Brandon Cruz from Bronx, N.Y., sands part of USS Kitty Hawk's (CV 63) flight deck to prepare the surface for painting
aboard uss kitty hawk (cv-63)people
US Navy 031023-N-2385R-006 An HH-60H Seahawk assigned to the Indians of Helicopter Antisubmarine Warfare Squadron Six (HS-6) transports ordnance from USS Nimitz's (CVN 68) to USNS Kilauea (T-AE 26)
aboard uss nimitz (cvn-68)hh-60h rescue hawk
US Navy 100303-N-3885H-172 An MH-60S Sea Hawk helicopter flies alongside USS George H.W. Bush (CVN 77)
vehicleship
US Navy 100406-N-4774B-356 An aircrew member aboard an SH-60F Sea Hawk helicopter observes flight operations
militaryvehicle
US Navy 100114-N-3038W-327 The guided-missile destroyer USS Sampson (DDG 102) and an MH-60S Sea Hawk helicopter assigned to the Wildcards of Helicopter Sea Combat Squadron (HSC) 23
helicopter sea combat squadron 23 (united states navy)navy
US Navy 100116-N-6247V-269 An air crewman comforts Haitian earthquake victims during a medical evacuation aboard an U.S. Navy SH-60F Sea Hawk assigned to the Red Lions of Anti-submarine Squadron (HS) 15
aboard uss carl vinson (cvn-70)sh-60f seahawk
US Navy 091108-N-3038W-073 Aviation Machinist's Mate 3rd Class Joseph Rosario, assigned to the Indians of Helicopter Anti-Submarine Squadron (HS) 6, performs maintenance on the main rotor hub of an HH-60H Sea Hawk helicopter
aboard uss nimitz (cvn-68)aviation machinist's mate
US Navy 091119-N-4053P-012 Aviation Structural Mechanic 3rd Class Jonathan Dowdy, assigned to the Indians of Anti-Submarine Squadron (HS) 6, performs corrosion treatment on the windshield wipers of an SH-60F Sea Hawk
lowlightlight
US Navy 090416-N-9150R-095 The amphibious assault ship USS Boxer (LHD 4) is underway in the Indian Ocean with an MH-60S Sea Hawk helicopter
vehiclesea
US Navy 090616-N-9123L-080 An SH-60B Sea Hawk helicopter assigned to the Warlords of Anti-submarine Squadron Light (HSL) 51, prepares to land aboard the guided-missile destroyer USS McCampbell (DDG 85)
militaryvehicle
US Navy 090224-N-6538W-064 An MH-60R Sea Hawk helicopter circles USS John C. Stennis (CVN 74
vehicleboat
US Navy 070814-N-3541A-137 An HH-60H Seahawk flies past the Nimitz-class aircraft carrier USS Nimitz (CVN 68) during a joint photo exercise
vehicleship
US Navy 110317-N-ZS026-109 An MH-60 Sea Hawk helicopter assigned to the Wildcards of Helicopter Sea Combat Squadron (HSC) 23
boatship
US Navy 051202-N-3488C-083 A plane captain assigned to the Diamondbacks of Strike Fighter Squadron One Zero Two (VFA-102), hand wipes a canopy of one of his squadron's F-A-18F Super Hornets
strike fighter squadron 102 (united states navy)aboard uss kitty hawk (cv-63)
US Navy 101025-N-8560K-047 A Sailor assigned to Helicopter Maritime Attack Squadron (HSM) 70 performs maintenance on an MH-60R Sea Hawk helicopter
maintenance of military aircraft on uss george h. w. bush (cvn-77)helicopter maritime strike squadron 70 (united states navy)
US Navy 110408-N-6505H-630 An HH-60H Sea Hawk helicopter assigned to Helicopter Anti-submarine Squadron (HS) 15 flies from the Military Sealift Com
shipnavy
US Navy 110512-N-QL471-061 A Sailor signals to an MH-60S Sea Hawk helicopter during a vertical replenishment aboard USS George H.W. Bush (CVN 77)
helicopter sea combat squadron 9 (united states navy)aboard uss george h. w. bush (cvn-77)
US Navy 110621-N-QL471-117 Sailors hook cargo nets to an MH-60S Sea Hawk helicopter assigned to Helicopter Sea Combat Squadron (HSC) 9 during a ver
vehiclenavy
US Navy 110520-N-RC734-207 Engineman 3rd Class Sisco Elekana, right, and Engineman Fireman Emmanuel Robinson refuel a MH-60S Sea Hawk helicopter
helicopter sea combat squadron 26 (united states navy)people
US Navy 110708-N-XQ375-364 An MH-60S Sea Hawk helicopter transfers pallets of stores from the Military Sealift Command fast combat support ship USN
boatsea
US Navy 110726-N-QD416-075 An MH-60S Sea Hawk helicopter transfers cargo from USNS Lewis and Clark (T-AKE 1) to USNS Comfort (T-AH 20)
helicopter sea combat squadron 26 (united states navy)usns lewis and clark (t-ake-1)
US Navy 110816-N-YX920-162 An SH-60 Sea Hawk helicopter assigned to Helicopter Mine Countermeasures Squadron (HM) 15 flies alongside the mine count
boatsea
US Navy 050711-N-3019M-010 Four U.S. Army UH-60 Black Hawk helicopters conduct a flyover during a memorial service for five Sailors assigned to SEAL Delivery Vehicle Team One (SDVT-1)
blue skysky
US Navy 100923-N-6427M-134 Sailors aboard the aircraft carrier USS Harry S. Truman (CVN 75) connect a cargo pallet to an MH-60S Sea Hawk helicopter
helicopter sea combat squadron 28 (united states navy)aboard uss harry s. truman (cvn-75)
US Navy 071027-N-7883G-010 Visitors tour the flight deck of the USS Kitty Hawk (CV 63). More than 23,000 people visited the Navy's oldest aircraft carrier during a port visit
vehiclenavy
US Navy 091120-N-1644H-146 Sailors assigned to the guided-missile destroyer USS Curtis Wilbur (DDG 54) enter the water to recover an exercise torpedo dropped by an SH-60B Sea Hawk Helicopter
vehiclewater
Harry M. Hoxsey, a former coal miner with an 8th grade education and no medical training made millions hawking quack cancer “cures” , to desperate patients for more than three decades until FDA was a
licoriceplants
US Navy 021114-N-3236B-033 F-A-18C Hornet plane captains assigned to Carrier Air Wing Five (CVW 5) try to keep warm during flight operations during Exercise Keen Sword 2003
aboard uss kitty hawk (cv-63)people
US Navy 021207-N-1810F-014 E-2C Hawkeye flies directly over the flight deck
militaryvehicle
US Navy 021207-N-1810F-015 S-3B Viking approaches the flight deck
aircraftvehicle
US Navy 110602-N-YZ751-397 An MH-60R Sea Hawk helicopter lands aboard USS George H.W. Bush (CVN 77)
vehicleship
US Navy 110606-N-TU221-586 An HH-60H Sea Hawk helicopter assigned to Helicopter Anti-submarine squadron (HS) 15 maneuvers during an air power demon
militarynavy
US Navy 110217-N-9793B-132 An SH-60S Sea Hawk helicopter lifts off from the aircraft carrier USS George H.W. Bush (CVN 77) during a vertical replen
vehicleboat
US Navy 091112-N-6233H-010 An SH-60B Sea Hawk helicopter from the Warlords of Helicopter Anti-Submarine Squadron Light (HSL) 51, lifts off at dawn from the flight deck of the aircraft carrier USS George Washington (CVN 73)
aboard uss george washington (cvn-73)
US Navy 091117-N-1644H-117 An HH-60H Sea Hawk helicopter from the Chargers of Helicopter Anti-Submarine Squadron (HS) 14 flies over the Seawolf-class attack submarine USS Connecticut (SSN 22)
sh-60f seahawk in flighthelicopters in flight
US Navy 100220-N-7508R-038 An MH-60S Sea Hawk approaches the multipurpose amphibious assault ship USS Bataan (LHD 5) after picking up cargo from the dock landing ship USS Carter Hall (LSD 50)
shipnavy
US Navy 100225-N-3038W-269 An MH-60S Sea Hawk helicopter assigned to the Wild Cards of Helicopter Sea Combat Squadron (HSC) 23 prepares to lift cargo
helicopter sea combat squadron 23 (united states navy)mh-60s seahawk
US Navy 100225-N-3038W-141 Two MH-60S Sea Hawk helicopters conduct a vertical replenishment at sea between USS Nimitz (CVN 68) and USNS Bridge (T-AOE 10)
helicopter sea combat squadron 23 (united states navy)aboard uss nimitz (cvn-68)
US Navy 100115-N-2953W-314 A sign is posted on the side of an SH-60F Sea Hawk assigned to the Tridents of Helicopter Anti-Submarine Squadron (HS) 3 to warn locals of helicopter safety concerns
2010 haiti earthquake relief efforts in port-au-princesh-60f seahawk
US Navy 100124-N-4971L-046 Sailors aboard USS Fort McHenry (LSD 43) carry injured Haitian medical evacuees to an MH-60S Sea Hawk helicopter
militarynavy
US Navy 100708-N-4044H-198 Sailors pull an MH-60S Sea Hawk helicopter to spot the aircraft for launch aboard USNS Mercy (T-AH 19)
aircraftvehicle
US Navy 100712-N-2918M-035 An SH-60F Sea Hawk helicopter assigned to the Indians of Helicopter Anti-Submarine Squadron (HS) 6 prepares to land aboard the aircraft carrier USS Nimitz (CVN 68)
aboard uss nimitz (cvn-68)helicopters in flight
US Navy 100318-N-7058E-161 Aviation Structural Mechanic 3rd Class Nicholas Ellingson from Helicopter Sea Combat Squadron (HSC) 22 signals for an MH-60S Sea Hawk helicopter
helicopter sea combat squadron 22 (united states navy)aboard uss freedom (lcs-1)
US Navy 100513-N-6720T-014 Two MH-60S Sea Hawk helicopters transport ordnance to the aircraft carrier USS George Washington (CVN 73)
militarynavy
US Navy 100202-N-5345W-095 crewmen and flight deck personnel unload medical relief supplies from an MH-60S Sea Hawk helicopter
helicopter sea combat squadron 26 (united states navy)operation unified response
US Navy 120209-N-DR144-361 MH-60S Sea Hawk helicopters assigned to Helicopter Anti-Submarine Squadron (HSC) 23 deliver supplies to the flight deck
aircraftvehicle
US Navy 110821-N-DX615-058 An MH-60S Sea Hawk helicopter assigned to the Wild Cards of Helicopter Sea Combat Squadron (HSC) 23 lands aboard the amp
helicopter sea combat squadron 23 (united states navy)vehicle
US Navy 111221-N-OY799-341 An MH-60S Sea Hawk helicopter from the Eightballers of Helicopter Sea Combat Squadron (HSC) 8 picks up stores
vehiclenavy
US Navy 120110-N-OY799-137 An MH-60S Sea Hawk from the Eightballers of Helicopter Sea Combat Squadron (HSC) 8 carries pallets past the Ticonderoga
oceansea
US Navy 120121-N-PB383-212 Sailors attach a cargo holder to an MH-60S Sea Hawk helicopter assigned to Helicopter Sea Combat Squadron (HSC) 21 on th
flight deck of uss new orleans (lpd-18)navy
US Navy 111025-N-VH839-048 An MH-60R Sea Hawk helicopter transfers supplies to the flight deck of the Arleigh Burke-class guided-missile destroyer
vehiclesea
US Navy 040228-N-5821P-009 Aviation Machinist's Mate 3rd Class Ryan Nunez, of Los Angeles, CA, and Aviation Electronics Technician 3rd Class Ricky Steele, of Antlers, OK, take a break on the flight deck as an F-A-18C Hornet launches
aboard uss kitty hawk (cv-63)
US Navy 051025-N-3488C-089 An F-A-18C Hornet, assigned to the Golden Dragons of Strike Fighter Squadron One Nine Two (VFA-192), lifts from the deck performing a touch and go landing
strike fighter squadron 192 (united states navy)aboard uss kitty hawk (cv-63)
Exit nike shoes
shoesboys
US Navy 100609-N-7948R-381 An MH-60S Sea Hawk helicopter delivers ammunition to the amphibious dock landing ship USS Pearl Harbor (LSD 52)
goldenship
Bald eagle
animalsbird
An Algerian Lady Hawking
falconry in arthorace vernet
orange hawkweed (Pilosella aurantiaca)
naturespring
US Navy 110602-N-YZ751-075 Naval Air Crewmen 3rd Class Stuart Thompson lowers a rescue basket from an MH-60S Sea Hawk helicopter during search and
mh-60s seahawk in flightnavy
US Navy 110830-N-ZZ999-279 Naval Air Crewman 2nd Class Aaron Hill, from Columbus, Ohio, looks out the cabin of an MH-60S Sea Hawk helicopter
helicopter sea combat squadron 8 (united states navy)aboard uss john c. stennis (cvn-74)
US Navy 110217-N-DR144-129 MH-60 Sea Hawk helicopters assigned to the Blackjacks of Helicopter Sea Combat Squadron (HSC) 21 deliver stores to the N
aircraftvehicle
US Navy 110301-N-SB672-331 Sailors attach a cargo pennant to an HH-60H Sea Hawk helicopter assigned to the Black Knights of Helicopter Anti-Submari
militaryvehicle
US Navy 100220-N-7508R-206 An MH-60S Sea Hawk helicopter transports supplies from the Military Sealift Command dry cargo ship USNS Sacagawea (T-AKE 2) to the multipurpose amphibious assault ship USS Bataan (LHD 5)
aboard uss bataan (lhd-5)navy
US Navy 100521-N-7908T-005 A Sailor guides irects an MH-60S Sea Hawk helicopter
militaryvehicle
US Navy 100727-N-2013O-128 An SH-60F Sea Hawk helicopter flies by Dokdo (LPH 6111)
militaryvehicle
US Navy 101013-N-6427M-102 Sailors aboard the aircraft carrier USS Harry S. Truman (CVN 75) connect cargo to an MH-60S Sea Hawk helicopter assigned
helicopter sea combat squadron 28 (united states navy)aboard uss harry s. truman (cvn-75)
US Navy 111201-N-OY799-067 Aviation Machinist's Mate 2nd Class Huytuan Nguyen, from San Diego, works on the tail rotor of an MH-60S Sea Hawk helico
helicopter sea combat squadron 8 (united states navy)aboard uss john c. stennis (cvn-74)
US Navy 100116-N-2953W-096 An SH-60S Sea Hawk helicopter flies from USS Carl Vinson (CVN 70) to transport volunteers to Haiti
aircraftvehicle
US Navy 100118-N-4774B-211 Sailors from the Nimitz-class aircraft carrier USS Carl Vinson (CVN 70) load cases of bottled water onto an SH-60S Sea Hawk helicopter for distribution to earthquake victims
grassfield
US Navy 090416-N-9150R-255 A search and rescue swimmer jumps from an MH-60S Sea Hawk helicopter
mh-60s seahawknavy
US Navy 091010-N-3830J-027 Aviation Structural Mechanic 2nd Class Jocelyn Joseph, assigned to Light Helicopter Antisubmarine Squadron (HSL) 51, performs maintenance on an SH-60F Sea Hawk helicopter
aboard uss blue ridge (lcc-19)aviation structural mechanic
US Navy 091006-N-3830J-006 Aviation Structural Mechanic 2nd Class Jocelyn Joseph and Aviation Machinist's Mate 2nd Class Steven Cruz conduct maintenance on an SH-60F Sea Hawk helicopter
aboard uss blue ridge (lcc-19)aviation structural mechanic
US Navy 090612-N-6720T-052 Sailors from the Chargers of Helicopter Anti-Submarine Squadron (HS) 14, apply insulating tape to the floor joists of an HH-60H Seahawk aboard USS George Washington (CVN 73)
aboard uss george washington (cvn-73)hh-60h rescue hawk
US Navy 091117-N-4010S-186 A Japan Maritime Self-Defense Force Mitsubishi SH-60J Sea Hawk helicopter flies over the guided-missile cruiser USS Cowpens (CG 63) during Annual Exercise (ANNUALEX 21G)
shipnavy
US Navy 080815-N-5961C-008 Two Sailors aboard the Military Sealift Command fast combat support ship USNS Bridge (T-AOE 10) hook cargo pendants to an SH-60 Sea Hawk helicopter
sh-60 seahawkarchitecture
US Navy 080821-N-1038M-036 Sailors man the rails aboard the aircraft carrier USS George Washington (CVN 73)
manning the rail on uss george washington (cvn-73)aboard uss kitty hawk (cv-63)
US Navy 080907-N-9134V-102 Boatswain's Mate 3rd Class Willy Holland and Lance Cpl. Christopher Marchewka hook a cargo net to an MH-60S Sea Hawk helicopter
helicopter sea combat squadron 26 (united states navy)aviation
US Navy 080923-N-2456S-024 ATC Phillip Crosby and AM2 Todd Weyh review phase inspection packages for job completion signature blocks for the SH-60F Sea Hawk aboard USS Theodore Roosevelt (CVN 71)
aboard uss theodore roosevelt (cvn-71)sh-60f seahawk
US Navy 080927-N-8593M-145 Chief Aviation Structural Mechanic Stephen F. Kimble paints an HH60H Sea Hawk helicopter assigned to the
aviation structural mechanicpeople
Animal wildlife icon
animalsicons
Common buzzard bird of prey raptor
animalsbird
Rough-legged buzzard animals the rough-legged buzzard
animalsbird
Orangerotes Habichtskraut (Hieracium aurantiacum) am Friedhof St. Johann in Saarbrücken
plantsmacro
Syrphe sur une fleur d'épervière orangée
animalsinsects
US Navy 031005-N-2143T-001 Explosive Ordnance Disposal Mobile Unit Eleven Detachment One (EODMU-11, DET 1) fast rope
militaryvehicle
US Navy 100124-N-9928E-011 Aviation Electrician's Mate 3rd Class Bryan Darlington, from Akron, Ohio, signals an MH-60S Sea Hawk helicopter
aboard uss john c. stennis (cvn-74)aviation electrician's mate
US Navy 100202-N-7058E-266 Flight-deck crewmen carry a simulated casualty away from an MH-60S Sea Hawk helicopter during an emergency landing drill aboard the littoral combat ship USS Freedom (LCS 1)
fire proximity suitspeople
US Navy 100303-N-3885H-096 An MH-60S Sea Hawk helicopter flies over the Atlantic Ocean
militaryaircraft
US Navy 091017-N-7478G-269 Aviation Structural Mechanic 1st Class Lawrence Smathers, right, instructs Aviation Structural Mechanic 3rd Class Adam Lawrence while performing maintenance on an SH-60F Sea Hawk helicopter aboard the
aboard uss blue ridge (lcc-19)sh-60f seahawk
US Navy 100115-N-6247V-083 Rear Adm. Ted N. Branch, Commander, Carrier Strike Group 1 (CSG-1), exits an Sea Hawk helicopter assigned to Helicopter Anti-Submarine Squadron (HS) 15 upon his arrival in Haiti Jan. 15
aboard uss carl vinson (cvn-70)
US Navy 100121-N-6410J-116 U.S. Army soldiers and Haitian service members rush medical patients to an MH-60S Sea Hawk helicopter
january 2010 in port-au-princestreets in port-au-prince
US Navy 100525-N-0864H-293 Seaman Drew Iverson launches an SH-60F Sea Hawk helicopter from the U.S. 7th Fleet command ship USS Blue Ridge (LCC 19)
lightglow
US Navy 090918-N-6538W-010 viation Structural Mechanic 2nd Class Evan Young, from Sonora, Calif., stabilizes a rotor blade on an MH-60S Sea Hawk
aboard uss john c. stennis (cvn-74)vehicle
US Navy 090921-N-3038W-047 Aviation Airman Catherine Ramos, assigned to the Indians of Helicopter Anti-Submarine Squadron (HS) 6, cleans the tail section of an SH-60F Sea Hawk helicopter in the hangar bay aboard the aircraft ca
aboard uss nimitz (cvn-68)aircraft cleaning
US Navy 091007-N-7478G-360 Sailors assigned to the flight deck crew of the amphibious command ship USS Blue Ridge (LCC 19) watch the sunset and the arrival of an SH-60F Sea Hawk helicopter
peoplesunset
3201 - 3300 of 6,422 Next page
/ 65