10,689 Free Images of Mi

romanticism,neoclassicismdrawings by ingres in the musée ingresvehiclewildlifeanimalsfrankenmuthxiaomilitenaturecar
Ingres - MI.867.1093 bis, Danseuse dite Vénus
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.2719, Didon assise
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.2851, Femme parlant à un enfant
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.2007.1.1, Tête de Niobé
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1665, Personnage en bas à droite
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1146, Ensemble de la composition
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3383, Tête d'un personnage grec
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3064, Homme nu de dos
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1487, Dante, Virgile et Raphaël
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3931, Groupe de personnages agenouillés
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.2960, Prêtre disant la messe
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.836, Homme embrassant une femme
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.4181, Statue-colonne de Corbeil
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1195, Base de colonne mauresque
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.2064, Tapisserie portant trois écussons
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3788, Chandelier d'église
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.2914, Femme lisant un livre
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.644, Famille aux enfants tétant
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.2144, Cuirasses et casques grecs
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3945, Personnage supportant une console
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1666, Personnage en bas à droite
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3245, Tête de Phocion
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1421, Le Bras du roi
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.2616, Jupiter sur un aigle
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.2061, Personnage avec une canne
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3198, Tête de jeune Phrygien
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3729, Chien de chasse dormant
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3899, Console et détails divers
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3823, Console et corniche d'autel
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3045, Femme assise par terre
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1962, Homme repoussant la foule
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.2132, Guerrier levant les bras
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3674, Groupe de femmes nues
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3166, Bras de femme plié
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.2122, Jambe gauche d'un cheval
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1172, L'Arétin
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.849, Tête de jeune homme
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3338, Bacchus s'appuyant sur l'Amour
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.2722, Ensemble de la composition
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.2931, Femme portant deux enfants
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1737, Jésus et saint Pierre
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3714, Tombeau avec un gisant
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1779, Draperie recouvrant un homme
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.2712, Ensemble de la composition
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.2288, Plis tombant d'une couverture
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.4119, Instrument de musique arabe
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3556, Arrière-train d'un cheval
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.4302, Intérieur de la cathédrale
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1530, Gluck
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1184, Femme sortant du bain
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1955, Homme levant le bras
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.325, Coussin sur un canapé
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3941, Martyre de saint Sébastien
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3412, Deux guerriers grecs combattant
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.2768, La Mort de Raphaël
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.639, Famille aux enfants tétant
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3033, Un jeune homme endormi
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3083, Croquis de deux personnages
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1189, Motif de tapis persan
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1047, Melpomène couronne l'Illiade
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1710, Judas
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.4293, Une église de Milan
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.2813, Chanoine agenouillé de dos
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1134, Les Villes
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3534, Croquis de deux personnages
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1040, Son corps
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1420, Les Jambes du Roi
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.3628, Femme embrassant un enfant
drawings by ingres in the musée ingresromanticism,neoclassicism
IMG 20181215 164927
vehiclecar
2013 MIS workshop monument tour
peoplegroup
2014 MIS Participants Career Workshop 1
national park servicearchitecture
Iguana in Kalakmul
wildlifeanimals
Ancient Murrelet, St. Joseph, MI, November 14, 2009
animalswater
Bonaparte's Gulls, flyover during rainstorm, Kentwood, MI, April 18, 2013
20180828-FNS-PJK-1410 TONED
shoppingfood
20190924-OSEC-PJK-02723 TONED
vehiclemi
20190924-OSEC-PJK-02350 TONED
peoplegroup
American Pipit, Huron Co., MI, 4 May 2013
ornithologywildlife
Hoary Redpoll, Sand Lake, MI, Feb 7, 2012
animal planet
Olive-sided Flycatcher, Rockford, MI, August 11, 2012
birdwatchingwildlife
Rufous/Allen's Hummingbird, Gowen, MI, 8 October, 2012
animalsred
Common Redpolls (part of 400+), Greenville, MI, 21 January 2013
winter
Yellow-throated Warbler, Millenium Park, Walker, MI, May 12, 2012
Lesser Black-backed Gull, South Haven, MI, Feb 24, 2007
Hoary Redpoll, Sand Lake, MI, Feb 7, 2012
birdwatchingwildlife
Bonaparte's Gulls, flyover during rainstorm, Kentwood, MI, April 18, 2013
Yellow-throated Warbler, Millenium Park, Walker, MI, May 12, 2012
American Redstart, Sand Lake, MI, 15 October 2012
natureleaves
Patio de mi casa
natureforest
20190924-OSEC-PJK-02230 TONED
vehiclemi
Tiger swallowtails
animalsnature
IMG 20181229 120523
platefood
20190924-OSEC-PJK-03335 TONED
floweroxford
Mi calle en primavera (sin edición)
landscapetree
Ingres - MI.867.3532, Persée et Méduse
drawings by ingres in the musée ingresromanticism,neoclassicism
Ingres - MI.867.1042, Phidias et Pindare
drawings by ingres in the musée ingresromanticism,neoclassicism
KUB Mi-Carême 1913
historicalhistory
Goya - Cercle, milieu, entourage de - Portrait de Mariana Waldstein, 9e marquise de Santa Cruz, 1799, MI 698, Francisco Goya
portrait de mariana waldstein, 9e marquise de santa cruz (mi 698)romanticism,rococo
IMG_20181215_165234
vehiclecar
20190924-OSEC-PJK-02259 TONED
vehiclemi
5301 - 5400 of 10,689 Next page
/ 107