20,828 Free Images of Operation

vehicleboatseamilitarynavyaircraftshipvesselmichael g. mullen in 2007group
US Navy 100124-N-2000D-080 Sailors assigned to the guided-missile cruiser USS Normandy (CG 60) assess the feasibility of docking supply ships in a bay near the village of Petit Trou De Nippes, Haiti
aboard uss carter hall (lsd-50)operation unified response
USS Astoria (CA-34) operating in Hawaiian waters on 8 July 1942 (NH 97682)
monochromeboat
US Navy 110802-N-XX949-001 Austal USA machinery operators Michael Wright, left, and Kyle Sealy monitor the first cut of aluminum for the sixth litt
aluminiumalabama
US Navy 120201-N-PC102-184 A Sailor mans a .50-caliber machine gun while conducting security escort operations for ships transiting out to sea thro
oceansea
US Navy 111004-N-MU720-067 Chief of Naval Operations (CNO) Adm. Jonathan Greenert with his counterpart, Adm. Masahiko Sugimoto, greets an officer o
jonathan w. greenert in 2011army
US Navy 111019-N-QL471-572 Capt. Brian E. Luther, commanding officer of the aircraft carrier USS George H.W. Bush (CVN 77), right, and Operations S
aircraftvehicle
USS George H.W. Bush (CVN 77) George H.W. Bush is supporting maritime security operations and theater security cooperation efforts in the U.S. 5th Fleet area of responsibility. (14299917890)
uss george h. w. bush (cvn-77)vehicle
USS George Washington flight operations 141014-N-EH855-021
carrier airborne early warning squadron 115 (united states navy)vehicle
USS George Washington operations 140922-N-IP531-009
militaryvehicle
US Navy 111215-N-OY799-165 Ship's Servicemen cut hair in the barbershop aboard the Nimitz-class aircraft carrier USS John C. Stennis (CVN 74)
barber shopshopping
USS Green Bay operations 150311-N-KE519-068
vehicleboat
US Navy 080816-N-8273J-209 Chief of Naval Operations (CNO) Adm. Gary Roughead speaks with Sailors during an all-hands call at Bagram Air Force Base
gary roughead in 2008jr
US Navy 071204-N-7656R-002 Naval Magazine (NAVMAG) Indian Island ordinance program director, Wayne Nagy speaks with Port Townsend locals about operations on NAVMAG Indian Island during a presentation at Port Townsend's Fort War
naval magazine indian islandfort worden
US Navy 070710-N-6854D-002 Sailors perform a no-load test on an aircraft catapult as part of pre-flight operations aboard the Nimitz-class aircraft carrier USS Dwight D. Eisenhower (CVN 69)
flight deck of uss dwight d. eisenhower (cvn-69)vehicle
US Navy 080630-N-8298P-157 Mass Communication Specialist 1st Class Eric Lippmann, assigned to Naval Expeditionary Combat Command Det. Combat Camera Underwater Photo Team, prepares to dive to conduct salvage operations
people1965
US Navy 070921-N-0696M-372 Chief of Naval Operations (CNO) Adm. Mike Mullen attends a frocking ceremony for three new chief petty officers assigned to Naval Post Graduate School (NPS)
united states navy images from montereymichael g. mullen in 2007
US Navy 070921-N-0696M-413 Chief of Naval Operations (CNO) Adm. Mike Mullen attends a frocking ceremony for three new chief petty officers assigned to the Naval Post Graduate School (NPS)
united states navy images from montereymichael g. mullen in 2007
US Navy 070501-N-0696M-049 Chief of Naval Operations (CNO) Adm. Mike Mullen speaks with Timothy B. Clark, Editor and President of Government Executive magazine during a leadership breakfast at the National Press Club
national press clubunited states
US Navy 070509-F-7806C-012 Navy Lt. Cmdr. Patterson, of Operational Support Hospital Unit, provides dental care to a Thai patient during the Cobra Gold 2007
pediatric dentistrypeople
US Navy 070509-N-0696M-357 Chief of Naval Operations (CNO) Adm. Mike Mullen Master listens to a question from a Sailor assigned to Naval Air Station Pensacola, during an all hands call
celebritiespeople
US Navy 080809-N-6674H-007 Chief Intelligence Specialist (Sel.) John Reeder, assigned to Joint Intelligence Operations Command, hammers supports for a deck to be built on a new house for a Habitat for Humanity community service
waianaehawaii
US Navy 080811-N-8273J-187 Chief of Naval Operations (CNO) Adm. Gary Roughead, center, speaks with Lt. Cmdr. Amanda Brookes and Capt. John Oberest while touring facilities at Naval Forces Central Command
bahraingroup
US Navy 090706-N-8273J-035 Chief of Naval Operations (CNO) Adm. Gary Roughead visits with Sailors assigned to Commander, U.S. Naval Forces Korea during an all-hands call at Balboni theater
gary roughead in 2009group
US Navy 100929-N-2855B-090 A rigid-hull inflatable boat patrols the water surrounding USS Stout (DDG 55) during maritime interdiction operations tr
waterboat
US Navy 100927-N-8273J-105 Chief of Naval Operations (CNO) Adm. Gary Roughead, left, meets with Chief of Defense Forces Lt. Gen. NEO Kian Hong whil
gary roughead in 2010interior
US Navy 090626-N-8273J-003 Chief of Naval Operations (CNO) Adm. Gary Roughead is interviewed by Mass Communication Specialist 2nd Class Rebekah Blowers during a podcast to discuss summer safety
whited.c.,
TA-4J Skyhawk and F-4 Phantom during air combat maneuvering 1980
aircraftvehicle
US Navy 050716-N-1804W-004 U.S. and Coalition joint forces man the Joint Operations Center aboard the U.S. Second Fleet flagship USS Iwo Jima (LHD 7)
united states navy images from the atlantic oceanaboard uss iwo jima (lhd-7)
US Navy 050909-N-9866B-012 Intelligence Specialist 1st Class Lance Howell, center, musters Operations Department Sailors at their lifeboat station during an abandon ship drill
peoplegroup
US Navy 050423-N-0295M-022 Commandant of the Marine Corps Gen. Michael Hagee looks on as Chief of Naval Operations Adm. Vern Clark speaks at the Navy-Marine Corps Relief Society Ball of 2005
michael w. hageevern clark
US Navy 070116-N-0535P-011 Sailors walk the flight deck of the Nimitz-Class aircraft carrier USS Harry S. Truman (CVN 75) in search of foreign object debris (FOD) before flight operations
aboard uss harry s. truman (cvn-75)vehicle
US Navy 070125-N-0775Y-063 Chief Utilitiesman James Sherry instructs Equipment Operator Constructionman Albert Amozarrutia in the direction to continue cleaning during a runway repair exercise at Kadena Air Base, Okinawa
militaryarmy
US Navy 030319-N-5319A-002 The mine countermeasure ship USS Dextrous (MCM 13) takes part in mine counter measure operations in the Arabian Gulf
vehiclewater
US Navy 061115-N-4649C-089 Doctors and hospital corpsmen from U.S. Naval Hospital Yokosuka, Japan Special Medical Operation Response Team (SMORT), assist a patient during a mass casualty drill held at the Hakozaki Fuel Terminal
united states navy images from yokosuka
US Navy 061118-N-1831S-038 Sailors assigned to USS Enterprise (CVN 65) return to Naval Station Norfolk following operations in support of the global war on terrorism
vehiclenavy
US Navy 060828-N-7130B-279 High above the flight deck aboard the Nimitz-class aircraft carrier USS Ronald Reagan (CVN 76), members of the ships Air Department watch as aircraft prepare to land during flight operations
aboard uss ronald reagan (cvn-76)
US Navy 070426-N-4163T-290 Chief Special Warfare Operator Larry E. Summerfield II, attached to the U.S. Navy Parachute Team, demonstrates proper parachute packing procedures to members of the Navy's Delayed Entry Program
parachute packinggroup
US Navy 111029-N-FC670-436 Chief of Naval Operations (CNO) Adm. Jonathan Greenert greets a Sailor aboard the Virginia-class attack submarine USS C
watership
US Navy 110412-N-ZB612-065 Chief of Naval Operations (CNO) Adm. Gary Roughead salutes Israel Naval Forces sailors after meeting with Vice Adm. Eli
united states navy images from israelgary roughead in 2011
US Navy 110414-N-7293M-413 Operations Specialist 3rd Class David Wolery, assigned to the visit board, search and seizure (VBSS) team from the amphi
aboard uss ponce (lpd-15)navy
US Navy 110509-N-DR144-578 Operations Specialist 3rd Class David Ayala talks with other watch standers on a sound-powered telephone while standing
aboard uss carl vinson (cvn-70)naval signalling lamps
US Navy 110318-N-SB672-562 Sailors speak with Japanese men about providing additional supplies during a humanitarian assistance mission
helicopter anti-submarine squadron 4 (united states navy)2011
US Navy 110325-N-ZB612-008 Chief of Naval Operations (CNO) Adm. Gary Roughead speaks with retired Vice Adm. Daniel Oliver, president of the Naval P
march 2011 in californiagary roughead in 2011
US Navy 110329-N-5538K-217 A CH-46E Sea Knight helicopter carrying humanitarian assistance supplies takes off from the forward-deployed amphibious
aboard uss essex (lhd-2)2011
US Navy 100921-M-6740B-304 U.S. Navy Capt. Thomas M. Negus, commodore of Operation Continuing Promise 2010, visits with local Nicaraguan children a
continuing promise 2010thomas m. negus
US Navy 110315-N-IC111-117 Naval Air Crewman 2nd Class Zack DelCorte ands bottled water to a Japanese citizen
people2011
U.S. Sailors fight a simulated fire during a general quarters drill in the hangar bay of the aircraft carrier USS Harry S. Truman (CVN 75) March 8, 2014, in the Gulf of Oman 140308-N-ZG705-433
uss harry s. truman (cvn-75)operation enduring freedom
U.S. Sailors fight a simulated fire during a general quarters drill in the hangar bay of the aircraft carrier USS Harry S. Truman (CVN 75) March 8, 2014, in the Gulf of Oman 140308-N-ZG705-349
uss harry s. truman (cvn-75)operation enduring freedom
U.S. Sailors fight a simulated fire during a general quarters drill in the hangar bay of the aircraft carrier USS Harry S. Truman (CVN 75) March 8, 2014, in the Gulf of Oman 140308-N-ZG705-415
uss harry s. truman (cvn-75)operation enduring freedom
USS Ronald Reagan flight deck operations 130713-N-HT107-184
militaryvehicle
A-7E VA-94 on cat of USS Enterprise (CVN-65) 1988
militaryvehicle
F-14B VF-102 AIM-54 and AIM-9
militaryaircraft
Sailor fabricates an arresting gear cover at sea. (9554193131)
men at work in the united statesoperation enduring freedom
Flickr - Official U.S. Navy Imagery - The SECNAV observes nighttime flight operations.
lightnight
US Navy 090424-N-8273J-122 Chief of Naval Operations (CNO) Adm. Gary Roughead speaks with and answers questions from students in the Naval Junior ROTC program at Annapolis High School
united states naval academy community servicegary roughead in 2009
US Navy 070604-N-0989H-041 Guatemalan sailors and 0fficer cadets practice tying knots during small boat operations subject matter exchanges on board High Speed Vessel (HSV) 2 Swift
ropeworksmilitary
US Navy 070608-N-0989H-044 Guatemalan sailors conducts bumper drills along side High Speed Vessel (HSV) 2 Swift during small boat operations subject matter exchanges
us navy in puerto barriosexterior of hsv-2 swift
US Navy 070620-N-3857R-001 Personnel Specialist 3rd Class Ray Guedry, of Naval Mobile Construction Battalion (NMCB) 1, splices a communications wire in the ant farm of the battalion's forward operating base (FOB) during Operati
personnel specialist (united states navy)camp shelby
US Navy 091221-N-4482V-005 Rear Adm. Joseph Kilkenny, commander of Naval Education and Training, and his senior staff, listen to Lt. j.g. Justin Guernsey explain the operation of the control panel
joseph f. kilkennyrichard l. james
US Navy 091223-N-9898L-006 Aviation Electronics Technician 2nd Class Alejandro Benavides renders honors as Aviation Structural Mechanic 1st Class Andrew Johnson lowers the American flag outside of the Navy Operational Support C
wintersnow
US Navy 091225-N-8421M-103 t. Jon Sunderland dresses in a Santa suite while directing aircraft operations aboard the aircraft carrier USS Nimitz (CVN 68) Christmas Day
santa claus costumesnavy
Image title: Old photo of bison transplanting operation Image from Public domain images website, http://www.public-domain-image.com/full-image/vintage-photography-public-domain-images-pictures/old-pho
animalsmammals
Der junge Lord (Henze) playbill
der junge lordplaybills
KC-130J Hercules
aerial refuelinghercules
Check the computer connection
technologyspace
Rheiderland include a harvest tractors
agriculturefarm
2021-02-20-Tohoku-Shinkansen-operation-information-at-Tokyo-Station-02
2021 fukushima earthquakeself-published work
VolkerRail 203-1 Tom, 203-3 Spike & 203-2 Jerry pic1
passenger trainvehicle
Veolia 6760 te Heerlen station
self-published workvehicle
MARSOF Afghanistan-15
resolute supportmazar-e-sharif
Defense.gov News Photo 110921-N-GZ277-053 - The guided missile destroyer USS Stockdale DDG 106 leads a formation of ships with the Carl Vinson Carrier Strike Group as they conduct operations in
boatship
F3H-2M of VF-61 on USS Saratoga (CVA-60) 1957
militaryvehicle
F-4J Phantom II of VF-33 in flight in 1970
aerial photographs of f-4 phantom ii in flightf-4j phantom ii
US Navy 040423-N-6234S-082 The mine warfare ship USS Raven (MHC 61) conducts local operations in the North Arabian Gulf
boatsea
U.S. Navy Adm. Jonathan Greenert, foreground, second from left, the chief of Naval operations, watches from the sidelines with a U.S. Naval Academy alumnus as the Midshipmen run onto the football field to play 120901-N-WL435-490
jonathan w. greenert in 2012stadium
US Navy 070501-N-0696M-079 Chief of Naval Operations (CNO) Adm. Mike Mullen speaks with Timothy B. Clark, Editor and President of Government Executive magazine during a leadership breakfast at the National Press Club
united stateslight
US Navy 061115-N-0490C-006 Aviation Warfare Systems Operator 2nd Class Matthew J. Gensler, assigned to the Nightdippers of Helicopter Anti-submarine Squadron Five (HS-5), verifies his receipt for his procurement of fuel
aboard uss dwight d. eisenhower (cvn-69)people
US Navy 060522-N-7526R-001 Operations Specialist 2nd Class Gil Diaz concentrates on a radar screen as he communicates with an aircraft during his air defense weapons coordinator (ADWC) watch, in the Combat Direction Center (CDC
combat direction center of uss ronald reagan (cvn-76)
US Navy 070307-N-6710M-004 A Landing Craft Utility (LCU) prepares to enter the well deck of amphibious transport dock ship USS Tortuga (LSD 46) while conducting amphibious operations
waterboat
USS Carl Vinson supports Operation Inherent Resolve 141104-N-TP834-377
lightdark
US Navy 070822-N-8923M-142 Machinery Repairman 2nd Class Patrick Koenig machines metal on a lathe in the machine shop of Nimitz-class aircraft carrier USS Harry S. Truman (CVN 75)
aboard uss harry s. truman (cvn-75)machinery repairman
US Navy 071211-N-9623R-003 Seabees from Naval Mobile Construction Battalion (NMCB) 17 load a patient into a UH-60 Blackhawk medical evacuation helicopter
fort hunter liggettuh-60 black hawk
US Navy 071213-N-8273J-109 Chief of Naval Operations (CNO) Adm. Gary Roughead appears before the House Armed Services Committee to give testimony and answer questions concerning the unified maritime strategy
house armed services committee hearing on 2007-12-13gary roughead in 2007
US Navy 070719-N-0696M-686 Chief of Naval Operations (CNO) Adm. Mike Mullen speaks with the crew aboard amphibious assault ship USS Boxer (LHD 4)
michael g. mullen in 2007dark
US Navy 070724-N-6247M-001 Aerographers Mate 3rd Class Daniel Miles and Aerographers Mate 1st Class Jessica Martin take weather observations from the rooftop of the operations building at Naval Air Station Whidbey Island
naval air station whidbey island in the 2000saerographer's mate
US Navy 070921-N-0696M-432 Chief of Naval Operations (CNO) Adm. Mike Mullen attends a frocking ceremony for three new chief petty officers assigned to the Naval Post Graduate School (NPS)
michael g. mullen in 2007group
US Navy 080701-N-0640K-191 Aviation Warfare Systems Operator 2nd Class Jeremy Thomas, a native of Warren, Ohio, waves to citizens of the Municipality of Balasan, Philippines after delivering hygiene items, water and tents to th
peopleiloilo
US Navy 080712-N-9134V-200 The visit, board, search and seizure team assigned to the amphibious dock landing ship USS Carter Hall (LSD 50) conducts maritime interdiction operations
vehiclewater
US Navy 080726-N-3392P-162 The visit, board, search and seizure teams assigned to the amphibious dock landing ship USS Carter Hall (LSD 50) conduct approach operations
vehiclewater
US Navy 070618-N-7128A-041 Aviation Boatswain's Mate (Equipment) 1st Class Juan Salcedo signals the shooter after the catapult's final check that a jet is clear to launch during flight operations aboard nuclear-powered aircraft
aboard uss nimitz (cvn-68)aviation boatswain's mate
US Navy 070619-N-3857R-004 Personnel Serviceman 3rd Class Ray Guedry assigned to Naval Mobile Construction Battalion (NMCB) 1 pull communications wire across the battalion's forward operating base at Camp Shelby
militaryarmy
US Navy 081105-N-9520G-014 Operations Specialist 3rd Class Cindy R. Skinner, from Madison Heights, Mich., uses a telescopic alidade to make reports on surface contacts aboard the amphibious assault ship USS Essex (LHD 2)
aboard uss essex (lhd-2)alidade
US Navy 081103-N-2183K-058 A CH-53E Super Stallion helicopter descends to the flight deck during operations to disembark Marines
vehicleboat
US Navy 080216-N-8273J-079 Chief of Naval Operations (CNO) Adm. Gary Roughead walks to the podium before presenting the Black Engineer of the Year Award for Career Achievement in Government
lightdark
US Navy 080607-N-9689V-011 Cmdr. Kenneth Kubis, director of surgical services aboard the Military Sealift Command hospital ship USNS Mercy (T-AH 19), uses an operating microscope
humanitarian aid in the philippinesaboard usns mercy (t-ah-19)
US Navy 110523-N-ZB612-008 Chief of Naval Operations (CNO) Adm. Gary Roughead speaks with service members stationed at the U.S. Embassy in Madrid
indooryoung
US Navy 110601-N-RC734-164 Marines disembark Landing Craft Utility (LCU) 1648 during stern gate marriage operations aboard USS Comstock (LSD 45)
vesselboat
US Navy 110321-N-0864H-310 Sailors arrange pallets on the main deck aboard the U.S. 7th Fleet command ship USS Blue Ridge (LCC 19) during a vertica
peoplecity
US Navy 110321-N-IC111-206 Naval Air Crewman 2nd Class Chris Tautkus gestures to a Japanese child to return his helmet
helicopter anti-submarine squadron 4 (united states navy)2011
US Navy 110319-N-DM338-030 Sailors and Marines load food and humanitarian supplies on the flight deck of the aircraft carrier USS Ronald Reagan (CV
uss ronald reagan (cvn-76) humanitarian aid2011
10901 - 11000 of 20,828 Next page
/ 209