17,922 Free Images of Oregon

cc-zerofiles uploaded by daderotplantsanimalsmilitaryaircraftvehicleaviationjetnature
Foto taken by Lumbar 16:28, 6 November 2005 (UTC) in Osnabrück
pinaceaeplants
Older man seated next to gravesite covered with flowers, Oregon, ca. 1913., circa 1913
outdoor benches in oregoncemeteries in oregon
Mahonia ×media berries blue
berriesnature
Scutellinia scutellata 8699966
scutellinia scutellatapages with maps
Puma concolor and Odocoileus hemionus hemionus - Mount Angel Abbey Museum - Mount Angel Abbey - Mount Angel, Oregon - DSC09994
self-published workcc-zero
North American FJ-3 Fury, 1955 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00598
militaryvehicle
The long narrow canyon that surrounds the Deschutes River in the Steelhead Falls area pulls visitors away from nearby human influences and places them in a spectacular steep-sloped channel of unique c
reptilesanimals
Red Crossbill (Loxia curvirostra) photographed in the Deschutes National Forest
animalsbird
Gewöhnliche Mahonie (Mahonia aquifolium) im Ebertpark Hockenheim
plantsleaf
Gewöhnliche Mahonie (Mahonia aquifolium) im Landesgartenschaupark Hockenheim
mahonia aquifoliumplants
Gewöhnliche Mahonie (Mahonia aquifolium) in Hockenheim
natureplants
Gewöhnliche Mahonie (Mahonia aquifolium) in Hockenheim - Ursprung: Nordamerika - an diesem Standort womöglich verwildert
plantsleaf
Big wildlife nature
sciencefish
Auster AOP Mark 6, 1945 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00641
militaryvehicle
Douglas C-47A Skytrain, 1944 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00355
militaryvehicle
Consolidated PBY-5A Catalina, 1953 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00733
militaryvehicle
Northrop Grumman RQ-4 Global Hawk mock-up, Block 10, 1998 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC01114
self-published workcc-zero
Republic RC-3 Seabee, 1947 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00724
militaryvehicle
US Navy 050325-F-7169B-029 Navy Capt. Bruce Biermann, a dentist assigned to the Portland, Oregon Reserve Center, reviews the dental records of a Old Harbor resident
old harboralaska
SP 8234 at Semaphore 6089 between Yoncalla and Drain, OR on July 30, 1982 (33100388746)
trafficoregon
Gewöhnliche Mahonie (Mahonia aquifolium) im Ebertpark Hockenheim
plantsleaf
Chrysanthemums - Lan Su Chinese Garden - Portland, Oregon - DSC01306
naturespring
Messerschmitt Me-262A-1 Schwalbe, 1942 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00648
militaryvehicle
Ursus americanus and Odocoileus hemionus columbianus - Mount Angel Abbey Museum - Mount Angel Abbey - Mount Angel, Oregon - DSC09976
ursus americanusanimals
AN-ALR-50XC and unknown unit - Lockheed SR-71A Blackbird, 1966 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC01024
self-published workcc-zero
The long narrow canyon that surrounds the Deschutes River in the Steelhead Falls area pulls visitors away from nearby human influences and places them in a spectacular steep-sloped channel of unique c
reptilesanimals
Greater White-fronted Goose You are free to use this image with the following photo credit: Peter Pearsall/U.S. Fish and Wildlife Service
animalsbird
Blue-footed Booby, taken in the Galapagos Islands in March 2004. camera - canon eos30. lens - canon 28-135 f3.5-4.5USM.
animalsbird
The Rogue River is a spectacular wildlife viewing area. Opportunities abound to see bald eagles, golden eagles, ospreys, great blue herons, Canada geese, and a variety of ducks. You may see the speedy
animalsmammals
Gewöhnliche Mahonie (Mahonia aquifolium) in Hockenheim
springplants
Mahonia aquifolium flower close up, Dehesa Boyal de Puertollano, Spain
springplants
USA OR John Day Fossil Beds National Monument
basinbeds
Willamette River at Portland, Oregon, 1908
black and white panoramic photographs of citiespanoramics in portland, oregon
Waterfall highway 58 beauty
landscapetree
Scutellinia scutellata 8699961
scutellinia scutellatafungus
SP 8234 passing the semaphores at MP 632.3 east of Walker, OR in July 1982 (33081928902)
trafficoregon
Interior view - Portland Art Museum - Portland, Oregon - DSC08761
interior designlight
Boeing Stearman Model 75 Kaydet, built as US Navy N2S-5, 1943 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00543
militaryaircraft
The Rogue River is a spectacular wildlife viewing area. Opportunities abound to see bald eagles, golden eagles, ospreys, great blue herons, Canada geese, and a variety of ducks. You may see the speedy
animalsbird
Bell AH-1F Cobra, 1965 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC01003
militaryvehicle
Lockheed P2V-5F Neptune, 1954 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00424
militaryvehicle
Lockheed F-94C Starfire, 1949 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00430
militaryvehicle
Oldfield Baby Great Lakes, 1997 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00699
militaryaircraft
OKB Mikoyan i Guryevich MiG-17A Fresco, 1953 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC01081
militaryvehicle
Gewöhnliche Mahonie (Mahonia aquifolium) in Hockenheim
plantsleaf
Gewöhnliche Mahonie (Mahonia aquifolium) in Hockenheim
plantsleaf
Gewöhnliche Mahonie (Mahonia aquifolium) in Hockenheim
springplants
The long narrow canyon that surrounds the Deschutes River in the Steelhead Falls area pulls visitors away from nearby human influences and places them in a spectacular steep-sloped channel of unique c
wildlifeanimals
UNITED STATES OF AMERICA. Oregon, Benton Co., BJLS 2005, PRS 2009, PRS 2011, Exemplar; this sample has been published under the name Adelpha bredowi, <a href="http://nymphalidae.utu.fi/story.ph
butterflyanimals
Long-toed salamander adult (Ambystoma macrodactylum).
amphibiaanimals
Lincoln city beach vacation
travelwater
Canis lupus occidentalis and Rangifer tarandus pearyi - Mount Angel Abbey Museum - Mount Angel Abbey - Mount Angel, Oregon - DSC09986
canis lupus occidentalisself-published work
Curtiss-Wright J65-W-3 engine, as installed in the Republic F-84F Thunderstreak aircraft - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00580
self-published workcc-zero
Interior view - Portland Art Museum - Portland, Oregon - DSC08921
architecturelight
Interior view - Portland Art Museum - Portland, Oregon - DSC08765
interior designlight
Tires - Lockheed SR-71A Blackbird, 1966 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC01031
self-published workaircraft tire
SP helpers 9381 at Semaphore 6089 between Yoncalla and Drain, OR on July 30, 1982 (33100388156)
oregondrain
The Rogue River is a spectacular wildlife viewing area. Opportunities abound to see bald eagles, golden eagles, ospreys, great blue herons, Canada geese, and a variety of ducks. You may see the speedy
animalsbird
The Rogue River is a spectacular wildlife viewing area. Opportunities abound to see bald eagles, golden eagles, ospreys, great blue herons, Canada geese, and a variety of ducks. You may see the speedy
animalsbird
Men and children standing in yard next to covered wagon, possibly Oregon, ca. 1905., circa 1905
historical images of tentscovered wagons
Beaches oregonbeaches capefalcon
landscapetravel
Scutellinia scutellata 8699962
fungusfungi
The Nativity by Taddeo Gaddi, 1335, paint and gold leaf on panel - Portland Art Museum - Portland, Oregon - DSC08955
self-published workcc-pd-mark
SP 3759 at Semaphore 6179, Comstock, OR. It looks like 3759 is a helper on July 30, 1982. (33142116725)
trafficoregon
SP SW1500 2602 at Signal 5730, N. Roseburg, OR on July 30, 1982 (32778266480)
vehiclecar
This 5 photo sequence is of SP Semaphore 6227 and sister at East Divide, OR on July 30, 1982 (32296308614)
1982 in rail transport in the united statesoregon
McDonnell Douglas F-15A Eagle, 1977 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC01095
militaryvehicle
Messerschmitt Bf 109 G-10 Gustav, 1944 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00575
militaryvehicle
Chrysanthemums - Lan Su Chinese Garden - Portland, Oregon - DSC01540
naturespring
The long narrow canyon that surrounds the Deschutes River in the Steelhead Falls area pulls visitors away from nearby human influences and places them in a spectacular steep-sloped channel of unique c
wildlifeanimals
The Rogue River is a spectacular wildlife viewing area. Opportunities abound to see bald eagles, golden eagles, ospreys, great blue herons, Canada geese, and a variety of ducks. You may see the speedy
animalsbird
Toledo yaquina river
landscapetravel
Chrysanthemums - Lan Su Chinese Garden - Portland, Oregon - DSC01524
naturespring
Flowers - Lan Su Chinese Garden - Portland, Oregon - DSC01596
springplants
Sikorsky UH-34D Seahorse, 1954 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00989
militaryvehicle
Flowers - Lan Su Chinese Garden - Portland, Oregon - DSC01304
naturespring
Chrysanthemums - Lan Su Chinese Garden - Portland, Oregon - DSC01552
naturespring
People of the World, Unite! Overthrow the American Imperialists! Overthrow the Soviet Revisionists! China, 1969, lithograph - Jordan Schnitzer Museum of Art - Eugene, Oregon - DSC09530 (cropped)
self-published workpd china
Roger's Six-photo Sequence at Siskiyou Summit Tunnel of the Southern Pacific RR's Line in Sothwestern Oregon (33024837562)
wintersnow
US Navy 090605-N-7783B-042 Rear Adm. James D. Kelly, deputy commander, Navy Region Northwest, kneels to be knighted
knightoregon
On April 23, BLM Range Management Specialists shot photos and video at a Sage-grouse lek near Louse Canyon geographic management area and McDermitt, Oregon. The sagebrush ecosystem is home to unique p
animalsbird
The Rogue River is a spectacular wildlife viewing area. Opportunities abound to see bald eagles, golden eagles, ospreys, great blue herons, Canada geese, and a variety of ducks. You may see the speedy
animalsmammals
The Rogue River is a spectacular wildlife viewing area. Opportunities abound to see bald eagles, golden eagles, ospreys, great blue herons, Canada geese, and a variety of ducks. You may see the speedy
animalswater
Gewöhnliche Mahonie (Mahonia aquifolium) in Hockenheim
plantsleaf
Two women standing in front of telephone booth, ca. 1909, circa 1909
telephone booths in the united statesblack and white photographs of women
B.S. Josselyn residence, Portland, Oregon, ca. 1909, circa 1909
mansions in oregongardens in oregon
08267-Portland, Ore.-1906-Thompson Fountain and County Court house-Brück & Sohn Kunstverlag
county courthouses in oregonparks in portland, oregon
Focke Wulf Fw-190A-7 replica, 1939 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00569
militaryvehicle
Tony McPeak service dress - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00685
self-published workcc-zero
A2C-C, AR1700 recorder unit, and DEF H - Lockheed SR-71A Blackbird, 1966 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC01020
self-published workcc-zero
Douglas DC-3A, 1936 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00692
militaryaircraft
Astro-Inertial Navigation System, 1962 - Lockheed SR-71A Blackbird, 1966 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC01058
self-published worknavigation system
Oregon Grape flowering in the shade of Ponderosa Pines at Skaha Bluffs Park
landscapetree
While Steens Mountain looms to the west, the shimmering salt flats of the Alvord Desert unfold to the east. The Alvord Desert playa, which can be either wet or dry depending on the time of year, is on
reptilesanimals
Gewöhnliche Mahonie (Mahonia aquifolium) in Hockenheim - an diesem Standort womöglich verwildert
plantsleaf
Red nature flora
naturespring
Chrysanthemums - Lan Su Chinese Garden - Portland, Oregon - DSC01564
naturespring
Chrysanthemums - Lan Su Chinese Garden - Portland, Oregon - DSC01528
naturespring
De Havilland DH-4, c. 1918, built by the Fisher Body Division of General Motors, modernized in 1923 by Boeing - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00507
self-published workvehicle
Tony McPeak service dress - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00687
self-published workcc-zero
3501 - 3600 of 17,922 Next page
/ 180