1,227 Free Images of Osprey

mv-22b ospreyaboard uss america (lha-6)vehiclenavyaircraftmilitarycrew of uss america (lha-6)aboard uss bataan (lhd-5)flyflight
US Navy 091101-N-5319A-001 An MV-22 Osprey assigned to the Golden Eagles of Marine Medium Tiltrotor Squadron (VMM) 162 prepares to take off from the amphibious assault ship USS Nassau (LHA 4)
mv-22b osprey on flight decksaboard uss nassau (lha-4)
US Navy 100124-N-8241M-179 An MV-22 Osprey assigned to the Golden Eagles of Marine Medium Tiltrotor Squadron (VMM) 162 taxis to the flight line at the airfield at Naval Station Guantanamo Bay
aircraftvehicle
US Navy 090529-N-9740S-313 An MV-22B Osprey assigned to Marine Medium Tiltrotor Squadron (VMM) 263 (Reinforced) is secured on the flight deck of the multi-purpose amphibious assault ship USS Bataan (LHD 5)
night shotnight
US Navy 091004-N-9740S-006 Marines assigned to the 22nd Marine Expeditionary Unit (22nd MEU) run sprints near an MV-22B Osprey
militaryvehicle
Bell-Boeing CMV-22B Osprey hovers at Amarillo, Texas (USA), on 7 February 2020 (200202-N-QO990-1004)
militaryvehicle
Osprey bird raptor
naturebird
Airfield Operation in Support of Operation Unified Response DVIDS244708
naval station guantanamo baymv-22b osprey
USS America operations 140824-N-EV723-030
aboard uss america (lha-6)mv-22b osprey
USS America tiger cruise 141015-N-MD297-056
mv-22b ospreypeople
USS America press conference 140831-N-FR671-157
mv-22b ospreypeople
USS Mesa Verde firefighting exercise 140220-N-BD629-105
uss mesa verde (lpd-19)mv-22b osprey
COMREL at Albert Schweitzer Municipal School 140806-N-LQ799-041
crew of uss america (lha-6)mv-22b osprey
COMREL at Albert Schweitzer Municipal School 140806-N-LQ799-272
crew of uss america (lha-6)mv-22b osprey
Soccer match with Brazilian navy 140806-N-MD297-552
mv-22b ospreygroup
Soccer match with Brazilian navy 140806-N-MD297-285
mv-22b ospreysport
Soccer match with Brazilian navy 140806-N-MD297-524
mv-22b ospreysport
Crew prepares for Rio departure 140809-N-YB590-109
mv-22b ospreynavy
Brazilian VIPs tour USS America 140804-N-LD343-014
aboard uss america (lha-6)mv-22b osprey
Bataan Amphibious Ready Group, 2014 Deployment 140502-N-IK431-048
22nd marine expeditionary unitmv-22b osprey
PHIBLEX 15 141003-N-UD469-045
31st marine expeditionary unitmv-22b osprey
Wildlife flight raptor
naturebird
Perches an osprey
animalsbird
Brazil distinguished visitors aboard USS America 140805-N-MZ309-015
aboard uss america (lha-6)mv-22b osprey
USS America tour 140824-N-CC789-194
mh-60s seahawkmv-22b osprey
USS America operations 140723-N-LQ799-051
militarynavy
PHIBLEX 15 141003-N-UD469-055
aircraftvehicle
Peleliu conducts flight operations 141123-N-LQ926-269
vehiclesea
Soccer match with Brazilian navy 140806-N-MD297-300
grasssport
Airfield Operations in Support of Operation Unified Response DVIDS244714
naval station guantanamo baymv-22b osprey
Australia bird wildlife
birdtree
USS America activity 140821-N-MD297-040
mv-22b ospreyvehicle
USS America 140819-N-MZ309-301
ray mabus in 2014mv-22b osprey
USS America press conference 140831-N-CC789-359
mv-22b ospreypeople
USS America operations 141003-N-MD297-134
mv-22b ospreyfly
USS America operations 140824-N-EV723-075
peoplegroup
USS Bonhomme Richard conducts flight operations. (12816460975)
mv-22 ospreynavy
US Navy 120131-N-NR955-119 An Osprey helicopter lands on the flight deck
aboard uss gunston hall (lsd-44)
Flight deck drills 140802-N-CC789-055
mv-22b ospreypeople
Brazilian VIPs tour USS America 140804-N-CC789-026
aboard uss america (lha-6)mv-22b osprey
Brazilian VIPs tour USS America 140804-N-CC789-060
aboard uss america (lha-6)mv-22b osprey
Women's Equality Day observance 140822-N-MD297-026
mv-22b ospreylight
Women's Equality Day observance 140822-N-MD297-054
mv-22b ospreygroup
US Navy 070814-N-8154G-114 A U.S. Air Force CV-22 Osprey, assigned to the 8th Special Operations Squadron (8th SOS), performs a fly-by of amphibious assault ship USS Bataan (LHD 5) during deck landing qualifications (DLQs)
militaryvehicle
US Navy 091106-N-8132M-120 An MV-22B Osprey from Marine Medium Tiltrotor Squadron 263 (Reinforced), 22nd Marine Expeditionary Unit, takes off from the amphibious assault ship USS Bataan (LHD 5)
militaryaircraft
US Navy 100126-N-6247V-171 A U.S. Customs and Border Patrol helicopter awaits passengers as a Navy MV-22 Osprey tilt-rotor aircraft lands in the background near the U.S. Embassy in Port-au-Prince, Haiti
aircraftvehicle
An Osprey (Pandion haliaetus) with a fist full of sushi. Photo taken with an Olympus E-P1 in the Merritt Island National Wildlife Refuge, FL, USA.Cropping and post-processing performed with The GIMP.
animalsbird
Osprey near Tagnum Beach Nelson, British Columbia, Canada
animalsbird
US Navy 101018-N-7508R-072 Aviation Boatswain's Mate Airman (Handling) Kelley Matthew and Aviation Boatswain's Mate Airman Justin Casey, from Brade
aircraftflight
US Navy 091002-N-3165S-089 Sailors aboard the multi-purpose amphibious assault ship USS Bataan (LHD 5) and embarked Marines from the 22nd Marine Expeditionary Unit (22nd MEU) move an MV-22B Osprey
vehiclenavy
US Navy 100124-N-7456N-034 An MV-22 Osprey assigned to the Golden Eagles of Marine Medium Tiltrotor Squadron (VMM) 162, is on the tarmac at Naval Station Guantanamo Bay
militaryvehicle
USS Arizona survivor visits USS America 141023-N-LQ799-184
aboard uss america (lha-6)mv-22b osprey
USS Arizona survivor visits USS America 141023-N-LQ799-085
aboard uss america (lha-6)mv-22b osprey
USS America visit 140719-N-YB590-049
militaryarmy
USS America operations 141003-N-MD297-084
mv-22b ospreyvehicle
USS America operations 141003-N-MD297-088
mv-22b ospreyvehicle
SNOOPIE team training evolution 140912-N-FR671-013
militarynavy
Chilean distinguished visitors aboard USS America 140823-N-MZ309-069
aboard uss america (lha-6)mv-22b osprey
Brazil distinguished visitors aboard USS America 140805-N-MZ309-022
aboard uss america (lha-6)mv-22b osprey
CWIS maintenance 141005-N-MD297-013
uss america (lha-6)mv-22b osprey
Brazilian naval VIPs tour USS America 140804-N-MD297-026
uss america (lha-6) flight deckmv-22b osprey
Chilean distinguished visitors aboard USS America 140823-N-MZ309-244
mv-22b ospreypeople
Chilean distinguished visitors aboard USS America 140823-N-LD343-006
mv-22b ospreycelebrities
An MV-22 does a touch-and-go aboard USS Carl Vinson. (8497231265)
vehicleseaside
Real Thaw 2017 IMG 5750a (33223538332)
aircraftvehicle
COMREL at Albert Schweitzer Municipal School 140806-N-LQ799-138
celebritiesgroup
USS America activity 140721-N-CC789-049
naval station guantanamo baymv-22b osprey
USS America activity 140721-N-CC789-037
naval station guantanamo baymv-22b osprey
USS Bonhomme Richard operations 160211-N-XK809-066
maintenance of military aircraft on uss bonhomme richard (lhd-6)mv-22b osprey
USS America activity 140721-N-CC789-021
naval station guantanamo baymv-22b osprey
USS Arizona survivor visits USS America 141023-N-LQ799-079
mv-22b ospreypeople
USS America tiger cruise 141014-N-MD297-006
mh-60s seahawkmv-22b osprey
PHIBLEX 15 141003-N-HU377-083
31st marine expeditionary unitmv-22b osprey
Soccer match with Brazilian navy 140806-N-MD297-334
sportgame
Venezuela raptor animal
animalsnature
Bird of prey tiwer africa
animalsbird
US Navy 080708-N-4014G-063 A V-22 Osprey aircraft from the
aboard uss bataan (lhd-5)vehicle
USS Anchorage commissioning 130423-N-DR144-716
mv-22b ospreyvehicle
USS America press conference 140831-N-CC789-251
militarynavy
USS America operations 140831-N-LD343-006
mv-22b ospreyvehicle
USS America reception 140807-N-EV723-101
aircraftvehicle
Ice Cream Social 141014-N-MD297-093
ice cream socialmv-22b osprey
COMREL at US Municipal School 140808-N-AC979-088
indooryoung
Bright Star DVIDS217571
vehiclenavy
Brazil distinguished visitors aboard USS America 140805-N-MZ309-030
aboard uss america (lha-6)mv-22b osprey
Soccer match with Brazilian navy 140806-N-MD297-345
sportgame
Chilean distinguished visitors aboard USS America 140823-N-MZ309-058
aboard uss america (lha-6)mv-22b osprey
Chilean distinguished visitors aboard USS America 140823-N-FR671-021
aboard uss america (lha-6)mv-22b osprey
HMS Amazon, Screw Sloop of War, destroyed by the Collision with the Cork Steam-Packet Osprey - ILN 1866
hms amazon (ship1865,
US Navy 091009-N-9740S-018 Sailors assigned to the multi-purpose amphibious assault ship USS Bataan (LHD 5) and embarked Marines from the 22nd Marine Expeditionary Unit (22nd MEU) move an MV-22B Osprey on the ship's flight deck
mv-22b osprey on flight decksvehicle
Image title: Osprey insect nest Image from Public domain images website, http://www.public-domain-image.com/full-image/fauna-animals-public-domain-images-pictures/insects-and-bugs-public-domain-images
animalsbird
A U.S. Marine Corps MV-22B Osprey tiltrotor aircraft assigned to Marine Operational Test and Evaluation Squadron (VMX) 22 departs from the amphibious assault ship USS America (LHA 6) Sept 140905-N-MD297-122
mv-22b ospreyvehicle
US Navy 110412-N-7508R-225 The crew of an MV-22B Osprey assigned to Marine Medium Tiltrotor Squadron (VMM) 263 (Reinforced) conducts pre-flight che
vehiclewater
US Navy 100617-N-3358S-042 An MV-22B Osprey assigned to the Golden Eagles of Marine Medium Tiltrotor Squadron (VMM) 162 lands aboard the amphibious transport dock ship USS Mesa Verde (LPD 19)
militarynavy
US Navy 110602-N-OS574-220 An MV-22B Osprey assigned to Marine Medium Tiltrotor Squadron (VMM) 263 (Reinforced), from the 22nd Marine Expeditionary
militaryvehicle
USS America operations 140819-N-LQ799-104
vehiclesea
USS America operations 140824-N-EV723-067
militaryvehicle
USNS John Ericsson activity 150131-N-CU914-009
11th marine expeditionary unitmv-22b osprey
USS Mesa Verde 140529-N-BD629-087
22nd marine expeditionary unitmv-22b osprey
Talisman Sabre 2015 150717-N-TW634-142
31st marine expeditionary unitmv-22b osprey
Ice Cream Social 141014-N-MD297-045
mv-22b ospreybowl
301 - 400 of 1,227 Next page
/ 13