19,073 Free Images of Silver

cc-zerofiles uploaded by daderotgoldjewelleryplantsgemsvehiclefashionjewelmetal
Anomobryum julaceum
bryaceaeplants
Out Nebraska way - Dalrymple. LCCN2012648644
puck1895
Out Nebraska way - Dalrymple. LCCN2012648644
puck1895
Buliera, Karol Filip Malcz, Fabryka Wyrobów Srebrnych, MHW 17382 a-c
media contributed by the museum of warsawsilver objects in poland
Silverkanna från Vislanda Hyltén-Cavallius Wärend och Wirdarne (1868) s196
wärend och wirdarne (1864)silver tankard
Sclateria naevia Castelnau
francis de castelnau's expedition - derivativebirds of south america
Muhammad Tughlak orders his brass coins to pass for silver, A.D. 1330
hutchinson's story of the nations — indiamuhammad bin tughluq
Whistler James Chelsea Wharf Grey and Silver 1875
landscapes by james mcneill whistler1875 paintings
Tibetan - A Ritual Box - Walters 572299 - Bottom
silver boxesexorcism
Silver medals of Neapolis, Philippi, and Aenos in Thrace - Clarke Edward Daniel - 1816
asia and africadrachma
Silver medal of Athens - Clarke Edward Daniel - 1816
travels in various countries of europeasia and africa
Ludwig Becker - Silver Dory, Cyttus australis - Google Art Project
art in museums victoriadrawings of fish
Perilampus atpar Mintern 151
fishes of india (day) - derivatecyprinidae illustrations
P599 Half-a-Crown of James II.--Silver
cassell's illustrated history of england vol 3coins of james ii as king of england
Mauve insect Free illustrations
insectsmauve
Silverware coffee silver
Penny
pennycoin
Shine luxury silver
icons ring
Locked-silver
media lacking a descriptionpadlock
White grey silver
natureplants
Mediterranean nature silver
animalsfish
Blue silver christmas
christmaswinter
Helicopter agusta-westland silver
militaryvehicle
Druzy drusy solar quartz
jewellerystones
Quartz bracelet stone
stonesmasks
Quartz bracelet stone
stonesmasks
Poole Silver Company - Old Colony History Museum - Taunton, Massachusetts - DSC03976
self-published workgold
Silver plate pitcher, 'Skyscraper', designed by Louis W. Rice, Wolfsonian-FIU Museum
self-published work2014 photographs
Spoon for 'Ice Bowl', Gorham Manufacturing Company, 1869, High Museum
self-published worksilver spoon
Rolls-Royce Silver Shadow sedan
vehiclecar
Alfa Romeo 75 facelift silver in Italy
vehiclecar
Hawaii school ivory and sterling silver earring, Honolulu Museum of Art
self-published worksilver earring
Rhesus Monkeys near the Silver River
animalsnature
Lit fern in Pukekura Park ((Festival of Lights).
plantspunga
Palmate pinnate alpine lady's mantle alps silbermantel
naturespring
Agate mask silver
jewellerystones
Silver nacre jewellery
jewelleryornament
Citrine jewellery trailers
jewellerysilver
Office paper packing
silverstripe
Rosewater sprinkler, Mughal dynasty, c. 1700, India, silver and gilt silver - Freer Gallery of Art - DSC05183
self-published workcc-zero
Cohannet Silver Company - Old Colony History Museum - Taunton, Massachusetts - DSC03980
self-published workgold
Bälte av nio på framsidan förgyllda plattor, 8*2 manglade kedjor av silver - Skoklosters slott - 92236
goldbelt
Timber of Grevillea robusta from tree grown in Johannesburg, South Africa
plantsbrown
Metal silver toyota
vehiclejapan
Money currency banks
businessusa
Silver alcohol flask
accessorymetal
Beacon Silver Company - Old Colony History Museum - Taunton, Massachusetts - DSC03985
self-published workgold
Silver whisper 2016 in Zeebrugge
vehiclewater
Silver ewer from Kashmir, Doris Duke Foundation for Islamic Art accession 57.43
self-published workibrik
Rosemar Silver Company - Old Colony History Museum - Taunton, Massachusetts - DSC03986
self-published workgold
Sterling silver covered cup by Amye Videau, c. 1752-3, Dayton Art Institute
self-published work2014 photographs
Bowl designed by Paulding Farnham, silver, copper and turquoise, 1900
self-published workmetal bowl
Brosch av matt silver i filigran, 1890 - Hallwylska museet - 110314
filigreegold
A picture of Crassula arborescens.
springplants
Microwave
home appliancessilver
Teapot, William Paradise, British, 1725-1726, silver, ivory - Fogg Art Museum, Harvard University - DSC01324
self-published workcc-pd-mark
Sugar Bowl, John Wisdome, British, 1716-1717, silver - Fogg Art Museum, Harvard University - DSC01330
self-published workcc-pd-mark
Coffeepot, Whiting Manufacturing Company, North Attleboro, Massachusetts, c. 1883, silver, gilt silver, ivory - Dallas Museum of Art - DSC04867
self-published workcc-pd-mark
Monstrance, Portugal, 1600s, gilt silver, silver, quartz - Museu Nacional de Soares dos Reis - Porto, Portugal - DSC00515
self-published workgold
Silver cup Hoby Philoctetes Nationalmuseet
philoctetescopenhagen
Francis Bruguière Light Abstraction
francis bruguière1925 photographs
Whistler James Mother of Pearl and Silver The Andalusian 1888-1900
american paintings in the national gallery of artportrait paintings by james mcneill whistler
Coin of Caesar, 4
cicero and the fall of the roman republicroman republican silver denari
Narragansett berry spoon, Gorham Manufacturing Company, Providence, Rhode Island, c. 1885, gilt silver - Dallas Museum of Art - DSC04860
self-published workgold
Silver Mclaren 650s Convertible Coupe On Gray Concrete Road
vehiclecity
Accessory adornment art
jewelleryornament
Centerpiece, Tiffany & Co., New York City, c. 1870-1874, silver - Portland Art Museum - Portland, Oregon - DSC08719
lightgold
Presentation pitcher, John Crawford, New York City, c. 1820, silver - Bennington Museum - Bennington, VT - DSC08703
self-published workcc-pd-mark
Karl Feiertag Blank geputzt
silver objects in artpaintings of servants
Tröja av silver- och guldbrokad som tillhört Karl X Gustav (1622-1660) - Livrustkammaren - 36793
images from livrustkammarenshirt
Silver auto automobile
silvermetal
Yellow Brown And Silver Butterfly Sitting On A Grass
butterflyanimals
Photo Of Pattern On Mercedes Concept Car Front Grill Silver Hexagons Create A Starry Sky Motif
vehiclecar
Tröja av silver- och guldbrokad som tillhört Karl X Gustav (1622-1660) - Livrustkammaren - 11055
images from livrustkammarenshirt
Tröja av silver- och guldbrokad som tillhört Karl X Gustav (1622-1660) - Livrustkammaren - 28232
images from livrustkammarenshirt
Tröja av silver- och guldbrokad som tillhört Karl X Gustav (1622-1660) - Livrustkammaren - 19617
images from livrustkammarenshirt
Tröja av silver- och guldbrokad som tillhört Karl X Gustav (1622-1660) - Livrustkammaren - 19670
images from livrustkammarenshirt
Silver penny of King Eadred (YORYM 2000 1495) reverse
numismatic collections of york museums trustmonarchs of northumbria
Pieter Andreas Rijsbrack - Still Life of Vegetables, a Pineapple and Other Fruit with a Silver Platter on a Ledge
still life paintings by pieter andreas rijsbrack
Fig 045 Nordwand des Torhofes von außen - Zustand 1906
silver gatesplit
Canis virginianus - 1818-1842 - Print - Iconographia Zoologica - Special Collections University of Amsterdam - UBA01 IZ22200265
vulpes in iconographia zoologicasilver fox
Drevnosti RG v3 ill079b - Pernath Silver
ceremonial macesflanged maces
Jewelry ring Free illustrations
jewelleryring
Accessory art brilliant
jewelleryaccessory
Bobby car sporty silver
vehicletoy
Wedding marry silver
weddingsilver
Glass silver old
celebritieswedding
Ring sterling silver stone
naturestones
Tigerware Jug with Silver Mounts, 1562-1563, Rhineland and London, salt-glazed stoneware with silver-gilt - Art Institute of Chicago - DSC09690
european pottery in the art institute of chicagocc-zero
Processional lantern, Goa, India, 1600s, silver - Museu do Oriente - Lisbon, Portugal - DSC07038
art of india in the museu do orienteself-published work
Leucadendron argenteum or Silvertree. Growing in gardens in Cape Town.
springtree
Kanna av delvis förgyllt silver med lock, handtag och fotring - Skoklosters slott - 91933
goldmug
US Navy 090329-N-2959L-169 Athletes race to the water to begin the swim portion of the 31st annual Superfrog Triathlon at Silver Strand State Beach
us army triathletespeople
Glass copper sterling silver earrings
naturestones
Thistle blossom bloom
natureplants
Cloudless blue sky silver roofs red square
travelcity
Cann, Zachariah Brigden, Boston, c. 1780, silver - Hood Museum of Art - DSC09308
self-published workcc-zero
Candlesticks pair, probably Portugal, 1750-18--, silver - Museu Nacional de Soares dos Reis - Porto, Portugal - DSC00556
self-published workcc-zero
Silver Lake Reservoir looking northwest pano 2015-10-11
landscapewater
Silver repoussé with gold vermeil plaques from Bolivia, Phoenix Art Museum
self-published workarchangels in art
3001 - 3100 of 19,073 Next page
/ 191