105,137 Free Images of Us

cc-zerofiles uploaded by daderotvehiclepd us not renewedmedia needing category review in use at de.wikipedianavymilitaryaircraftshipboat
American united states
symbolflag
Filigree glamour lips
accessorygold
Architectural ornament - Sofitel Washington DC Lafayette Square Hotel - 806 15th Street NW - Washington, DC - DSC04106
self-published workpd us not renewed
Architectural ornament - Sofitel Washington DC Lafayette Square Hotel - 806 15th Street NW - Washington, DC - DSC04135
self-published workpd us not renewed
Architectural ornament - Sofitel Washington DC Lafayette Square Hotel - 806 15th Street NW - Washington, DC - DSC04132
self-published workpd us not renewed
The rearview of Honda FIT SHUTTLE 15X (GG7) used as a race control car of Suzuka Circuit
vehiclecar
The rearview of MUGEN CIVIC TYPE R EURO (FN2) used as a medical car of Suzuka Circuit
vehiclecar
Ration Coupons for One Unit Graded Gasoline, 1945-1946 - National Museum of American History - DSC00072
self-published workcc-pd-mark
Relative Plott 3
self-published workwater sport
Relative Plott 8
self-published workwater sport
Relative Plott 6
self-published workwater sport
Rockwell Sabreliner 50, 1958, used for testing avionics and radar systems - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00710
self-published worknavy
Tortoise by Paul Manship, 1916, bronze, view 2 - Cape Ann Museum - Gloucester, MA - DSC01469
reptilesanimals
Chimney with smoke pollution - This photo has been released into the public domain. There are no copyrights you can use and modify this photo without asking, and without attribution
air pollutionsmoke
Case 08 - First Hardwood Weeding on Moist Sites - Dioramas in the Fisher Museum (Harvard Forest) - DSC07348
landscapelight
Christopher Columbus by Giovanni Cappelletti, Fonderia Artistica Ferdinando Marinelli, 1953, bronze, granite - Newport, Rhode Island - DSC04127
self-published workpd us not renewed
World War I memorial (Dartmouth Memorial Field) - Dartmouth College - DSC04659
self-published workpd us no notice
Ellie (Portrait of Eleanor Weber Hershey), by Samual Hershey, 1930, oil on canvas - Cape Ann Museum - Gloucester, MA - DSC01050
self-published workpd us not renewed
Twilight of the Gods by Lewis W. Rubenstein, painted 1930, unveiled 1937, fresco - Adolphus Busch Hall - Harvard University - DSC05648
self-published workpd us not renewed
Souvenir fan, paper, wood, silk, paint - Concord Museum - Concord, MA - DSC05660
self-published workpd us expired
Views on 28th June 2019 around an old villa that was used as an Islamic State base and then PMF base in Sinjar's old city 07
islamic state of iraq and the levantself-published work
GMC 6x6 US Army Field Red Cross Canteen, 4169405-S pic2
vehiclecc-zero
Girlie rack 44 in use jeh
pages with mapssidewalk
Grumman Tracker US-2N 159
militaryvehicle
Gorgon 2A, US Navy, tested in 1945 and 1946 - Evergreen Aviation & Space Museum - McMinnville, Oregon - DSC00791
aircraft at the evergreen aviation & space museumself-published work
IGFarbenWindfang
interiorindoor
Hoppenrader
self-published workcar
House chimney with dark smoke pollution - This photo has been released into the public domain. There are no copyrights you can use and modify this photo without asking, and without attribution
air pollutionsmoke
JB Kelly rowing Kelly Dr 1
schuylkill riverfairmount park
James Stephen Hogg by Pompeo Coppini - University of Texas at Austin - DSC08605
november 2015 in texasself-published work
James Stephen Hogg by Pompeo Coppini - University of Texas at Austin - DSC08609
november 2015 in texasself-published work
Klemmhülse Profil
metalmacro
Learning by Arcangelo Cascieri and Adio DiBiccari, oblique, 1958, dedicated 1961 - Parkman Plaza, Boston Common - Boston, MA - DSC05186
self-published workpd us not renewed
Learning by Arcangelo Cascieri and Adio DiBiccari, rear, 1958, dedicated 1961 - Parkman Plaza, Boston Common - Boston, MA - DSC05182
self-published workpd us not renewed
Motor-Sport-Museum am Hockenheimring, 1933 Imperia-Rudge 348cm 25Hp used by Ernst Loof, pic3
1933 in road transportvehicle
Blood chit, Doolittle Raid exhibit - Oregon Air and Space Museum - Eugene, Oregon - DSC09790
self-published workpd us military
Birthplace of Daniel Bissell, Patriot Spy of the American Revolution, 1754-1824 - Route 159, Windsor, Connecticut - DSC04349
self-published workpd us no notice
Japanese plane shot down over USS Cabot (CVL-28) during Battle of the Philippine Sea 1944
aircraft shootdownsuss cabot (cvl-28)
KY-38 (NESTOR) manpack analog radio voice encryptor, for use with PRC-72 radio, mid 1960s - National Cryptologic Museum - DSC07668
self-published workcc-zero
Spin room 14595796
light2016
F-14A VF-2 climbs with afterburners 1989
aerial photographs of f-14 tomcat in flightaircraft using afterburning
US Navy 031112-N-8955H-030 USS Blue Ridge and Commander, 7th Fleet, Sailors stand at parade rest during a Veterans Day ceremony held aboard the 7th Fleet command ship
aboard uss blue ridge (lcc-19)
US Navy 101130-N-9589S-155 USS George H. W. Bush (CVN 77), left, and USS Enterprise (CVN 65) are docked at Naval Station Norfolk
aboard uss george h. w. bush (cvn-77)vehicle
US Navy 031230-N-9693M-009 Navy cornerback Shalimar Brazier sacks Texas Tech quarterback B.J. Symons in the 2nd quarter of the EV1.Net Houston Bowl at Reliant Stadium in Houston, Texas
sportteam
US Navy 040221-N-2899A-001 Sailors assigned to the Naval Station Great Lakes Funeral Detail fold the National Ensign in honor of William Sylvester White
people of the united states navy in illinoisunited states navy images from chicago
US Navy 040210-N-4374S-004 High Speed Vessel Two (HSV 2) Swift glides through the waters of the Atlantic Ocean
shipsea
US Navy 040201-N-5319A-002 The nuclear powered aircraft carrier USS George Washington (CVN 73) and Carrier Air Wing Seven (CVW-7) transit the Straits of Gibraltar into the Mediterranean
general views of uss george washington (cvn-73)
US Navy 110623-N-OS574-032 A landing craft utility prepares to onload passengers and equipment from USS Mesa Verde (LPD 19)
boatship
US Navy 040202-N-1003P-001 The Ohio class fleet ballistic missile submarine USS Michigan (SSBN 727) enters into the Puget sound naval shipyard and intermediate maintenance facility
watership
US Navy 040218-N-5319A-004 Airman Keith Griner talks on his sound-powered phone to the fueling station below the flight deck
people of the united states navy with sound-powered telephonesaboard uss george washington (cvn-73)
US Navy 040327-N-5319A-003 Flight deck crewmen aboard USS George Washington (CVN 73) participate in a Scrub Ex of the flight deck during a no-fly day
flight deck maintenance aboard uss george washington (cvn-73)
US Navy 040219-N-4374S-009 Photographer's Mate 3rd Class Christian Weibull captures video images of the flight deck personnel during operations
aboard uss john f. kennedy (cv-67)people with video cameras
US Navy 040422-N-5821W-001 Italian firefighters dressed in chemical, biological, radiological (CBR) suits set up a perimeter of warning signs
arsenale militare marittimo di augustahazmat suit
US Navy divers and Belizean Coast Guard divers practice SCUBA emergency procedures in a pool 140624-N-IP743-311
underwaterwater
US Navy 040611-N-2972R-060 Marine Cpl. Anthony Borja, from Dededo, Guam, removes debris from an M-14 Assault Rifle with his field knife
united states navy images from the atlantic oceanpeople with knives
US Navy 040626-N-1464F-017 U.S. and Latin America Marines conduct riverine operations along the Amazon River
vehiclewater
US Navy 040707-N-1464F-009 Marine Cpl. Eric Harper, from 2 MACE out of Camp LeJeune, stands riot control during a training exercise
marine corps base camp lejeuneperu
US Navy 040809-N-0331L-002 Recovery personnel examine the wreckage of a Navy P-2V Neptune aircraft that crashed over Greenland in 1962
landscapemountain
US Navy 040908-N-6477M-053 Chief petty officer selectees assigned to Naval Station Everett and tenant commands participate in a 5-Kilometer POW-MIA run to commemorate those missing and killed in service to our country
naval station everett
US Navy 041117-N-8447S-001 The guided missile destroyer USS TheSullivans (DDG 68) provides rescue and assistance to the Pakistani dhow, Al Suleman
vehicleboat
US Navy 050627-N-0295M-223 A U.S. Navy RQ-2B Pioneer Unmanned Aerial Vehicle comes in for a landing
militaryvehicle
US Navy 050714-N-0413R-021 Aviation Machinist's Mate 3rd Class Jalvin Yuchongtian inspects the cover for an J-52 jet engine
aboard uss nimitz (cvn-68)pratt & whitney j52
US Navy 050627-N-0295M-175 Two Sailors wait for the signal to release an RQ-2B Pioneer Unmanned Aerial Vehicle prior to its flight demonstration
2005 at naval air station patuxent riveraircraft
US Navy 050607-N-4104L-001 U.S. Navy Chief Warrant Officer Douglas Park points out the parachute doors and discusses recovery procedures on a BQM-74E aerial target drone
vehiclewater
US Navy 050722-N-5390M-007 Adm. Mike Mullen delivers his remarks after relieving Adm. Vern Clark as Chief of Naval Operations (CNO)
2005 chief of naval operations change of command ceremonymichael g. mullen in 2005
US Navy 050730-N-5862D-206 U.S. Navy chief petty officer (CPO) selectees begin their first formation run as they begin their six-week odyssey aboard Naval Support Activity Mid-South
united states navy in millingtontennessee
US Navy 050723-N-5390M-001 Adm. Mike Mullen, Chief of Naval Operations (CNO), pays tribute to retired Vice Adm. James B. Stockdale
michael g. mullen in 2005naval academy chapel
US Navy 050909-N-8154G-168 The Mexican Navy amphibious ship Papaloapan (P-411) sits off the coast of Mississippi preparing to assist with Hurricane Katrina relief efforts along the Gulf Coast
waterboat
US Navy 020720-N-6492H-610 USS Kennedy Sailors man the rails as they pull into Marmaris, Turkey
vehicleboat
US Navy 021022-N-4374S-017 VP-1 conducts reconnaissance missions in the Middle East
militaryvehicle
US Navy 030101-N-0780F-002 Shore Patrol talk with Sailors
chania old harbourseaside
US Navy 030205-N-4048T-069 Fire Controlmen hold the wing clips closed on a NATO RIM-7 Sea Sparrow missile while uploading it into a launcher cell
maintenance of rim-7 sea sparrowaboard uss kearsarge (lhd-3)
US Navy 030218-N-6141B-001 Damage Controlman 3rd Class Rosanna Colp from Lakesport, Calif., practices donning her Advanced Chemical Protective Gear (ACPG)
damage controlmanpeople
US Navy 030212-N-1050K-001 Lt. Gen. Fahad Al-Amir, Kuwaiti Armed Forces Chief of Staff, during his recent visit to KNB
militaryarmy
US Navy 030326-N-1810F-015 Visibility on the flight deck aboard the aircraft carrier USS Kitty Hawk (CV 63) is greatly reduced as it passes through a strong sandstorm in the Arabian Gulf
flight deck of uss kitty hawk (cv-63)
US Navy 030327-N-0000X-003 An F-A-18 Hornet assigned to the Silver Eagles of Marine Fighter Attack Squadron One One Five (VMFA-115)
aircraftvehicle
US Navy 030305-N-1050K-006 Lt. Cmdr. Edan Antoine, Camp Patriot coordinator for chemical, biological and radiological (CBR) training and supplies, instructs an United Arab Emirates (UAE) Airman
m40 field protective maskpeople
US Navy 030402-N-1810F-008 An E-2C Hawkeye launches from the bow of USS Kitty Hawk (CV 63)
northrop grumman e-2c hawkeye aircraft carrier take-offsaboard uss kitty hawk (cv-63)
US Navy 030330-N-2143T-001 A Shared Air Reconnaissance Pod (SHARP) technician views flight operations from the O-10 level (10 levels above the flight deck)
uss nimitz (cvn-68) flight deckvehicle
US Navy 030407-N-5786V-502 Vice Adm. Scott A. Frye, Commander Sixth Fleet, addresses the crew of USS Theodore Roosevelt (CVN 71) in the ship's hangar bay
guests aboard uss theodore roosevelt (cvn-71)scott a. fry
US Navy 030402-N-1810F-009 An F-A-18C Hornet launches from the bow of USS Kitty Hawk (CV 63)
photographic silhouettes of peopleaboard uss kitty hawk (cv-63)
US Navy 030329-N-6141B-003 The Spruance Class destroyer USS Fletcher (DD 992) conducts underway operations in support of Operation Iraqi Freedom
navysea
US Navy 030402-N-1810F-005 F-A-18C Hornets are positioned on the bow of USS Kitty Hawk (CV 63) during flight operations
militaryaircraft
US Navy 030604-N-0000W-002 Firefighters from Commander, Naval Forces Japan Regional Fire Department are first on the scene, to assist simulated casualties during a helicopter crash training exercise
rescue trainingfirefighter
US Navy 030712-N-9999K-009 Capt. Jose. R. Corpus, right, Chief of Staff for Carrier Group 5, is presented the Bronze Star Medal
presentation of the bronze star medal (united states)aboard uss kitty hawk (cv-63)
US Navy 100213-N-2000D-108 A Marine plays with a Haitian child
operation unified responsegrand-goâve
US Navy 030701-A-0000S-001 hirty service members representing each branch of the military, to include the U.S. Coast Guard, await President Bush's arrival
east room (white house)group
US Navy 030708-N-4775H-004 Participants at the Navy Museum's recent Children's Maritime Craft Day make snappy salutes while modeling their newly made versions, of the Navy's Combination Cover
events at the washington navy yardchildren of the united states
US Navy 031111-N-5640H-069 Adm. Thomas B. Fargo and Hawaii Governor Linda Lingle gather for a group photo at the 2003 Governor's Veteran's Day Ceremony
thomas b. fargocelebrities
US Navy 070430-N-3271W-006 Mark Nasser, Director of Broadcasting for the Omaha Royals, interviews Rear Adm. Karen Flaherty, Deputy Commander, Navy Medicine, National Capital Area
johnny rosenblatt stadiumkaren flaherty
US Navy 070425-N-6247M-011 Naval Air Station Whidbey Island Commanding Officer, Capt. Syd Abernethy, gives some opening remarks during the Individual Augumentee (IA) evening
naval air station whidbey island in the 2000sgroup
US Navy 060804-N-0411D-026 U.S. Marine Lance Cpl. Simon Lin of Chino Hills, Calif., tightens up a corner rope while setting up the command tent at Camp Lonestar
united states navy in nginyangcamp lonestar
US Navy 060608-N-1713L-003 Sailors observe colors Thursday as USS Bulkeley (DDG 84) prepares to deploy with the Iwo Jima Expeditionary Strike Group (ESG)
warships at naval station norfolknavy
US Navy 060817-N-4482V-005 Members of Expeditionary Strike Group Five's (ESG-5) medical team, attached to USS Boxer (LHD 4), assist wounded Marines during a mass casualty drill
aboard uss boxer (lhd-4)
US Navy 060817-N-4482V-006 Members of Expeditionary Strike Group Five's (ESG-5) medical team, attached to USS Boxer (LHD 4), assist wounded Marines during a mass casualty drill
aboard uss boxer (lhd-4)
US Navy 060828-N-1805P-001 Chief of Naval Personnel, Vice Adm. John C. Harvey Jr. speaks to local media at the kick-off event for Cleveland Navy Week
officerjr
US Navy 061113-N-1713L-027 Line handlers standby for the arrival of the guided missile frigate USS Elrod (FFG 55) into its homeport at Naval Station Norfolk
militarynavy
US Navy 061123-N-3642E-001 Secretary of the Navy (SECNAV) The Honorable Dr. Donald C. Winter takes a moment in prayer with U.S. Marines and Sailors stationed at Camp Fallujah
celebritiesgroup
US Navy 061214-N-8534H-005 The Chief Petty Officer Association (CPOA) on board Yokosuka Naval Base cooks up and serves single Sailors and Marines a warm tasty meal for the holidays
barbecued foodpeople
US Navy 060106-N-4374S-009 Chief of Naval Operations (CNO) Adm. Mike Mullen speaks to the Sailors during a breakfast meeting at U.S. Naval Support Activity Bahrain
naval support activity bahrainbreakfast
30501 - 30600 of 105,137 Next page
/ 1052