33,596 Free Images of W

cc-zerovehicleaboard uss george h. w. bush (cvn-77)pages with mapsaircraftcitymilitaryaviationjetnavy
Bamban, Tarlac Museum, WWII Exhibit, No. 6 Rizal Avenue Old MacArthur Highway, Lourdes, Bamban, Tarlac; Macario W. Dela Cruz Memorial Hall, 2nd Lt. James H. Hart Memorial Library. 40th, 43rd & 38t
plantsfood
Yale Peabody Museum, Entomology Division Catalog #: YPM ENT 565968 Taxon: Catocala agitatrix Graeser (dorsal) Family: Erebidae Taxon Remarks: Animals and Plants: Invertebrates - Insects Collector: W.
butterflyanimals
Stenella attenuata syn. Prodelphinus attenuatus Views of two skulls of prodelphinus attenuatus (Gray), from Honolulu, H. I . Subject: Porpoises--Anatomy Tag: Aquatic Mammals
animalsmammals
Yet another image of Cygnus atratus, a species considered to be impossible. In hindsight this seems foolish, but so it goes. Our specimen is further confounding those revised views by revealing the w
animalsbird
20210418 165649 April 2021 in Białystok
architecturecity
SOPOT. AB-016
architecturetown
170805-N-FE442-097 (36025740150)
vehiclesea
170712-N-FE442-147 (35805450402)
militaryvehicle
Plac Konstytucji 3 Maja w Przemyślu 01
vehicletravel
Widok z tarasu wieży Zegarowej w Przemyślu 04 - Zasanie
travelcity
Kościół Wszystkich Świętych w Warszawie 01
travelcity
Miejsce parkingowe zarezerwowane dla osób niepełnosprawnych na parkingu osiedlowym w Tomaszowie Mazowieckim, grudzień 2018
disabilitysidewalk
Most Dębnicki w Krakowie 01
skylinewater
Uroczystość nadania imienia Prezydenta Lecha Kaczyńskiego Gazoportowi w Świnoujściu
joachim brudzińskigroup
Gazoport w Świnoujściu nadanie imienia Prezydenta Lecha Kaczyńskiego Terminalowi LNG
joachim brudzińskigroup
20180420-181017-lodz-teatr-2018
architecturecity
Granville Jones House Wausau
self-published workpages with maps
Bydgoski Rower Aglomeracyjny4 4-2015
peoplecity
Muskogee snowstorm 2021-02-15 1419 W Okmulgee Ave NE 1
wintersnow
Weird mystical cemetery
mysticcelts
US Navy 050423-N-0295M-022 Commandant of the Marine Corps Gen. Michael Hagee looks on as Chief of Naval Operations Adm. Vern Clark speaks at the Navy-Marine Corps Relief Society Ball of 2005
michael w. hageevern clark
US Navy 110520-N-QL471-413 An EA-18G Growler assigned to Electronic Attack Squadron (VAQ) 141, takes off from the aircraft carrier USS George H.W
vehicleboat
US Navy 110720-N-TU894-195 Air-Traffic Controller 1st Class David Viger controls aircraft in the Carrier Air Traffic Control Center aboard the airc
lightnight
US Navy 101205-N-3885H-304 An E-2C Hawkeye assigned to Carrier Airborne Early Warning Squadron (VAW) 120 approaches the aircraft carrier USS George
vehicleboat
US Navy 110131-N-3374C-068 A Sailor assigned to the air department aboard the aircraft carrier USS George H.W. Bush (CVN 77) watches an F-A-18E Sup
militaryvehicle
US Navy 100829-N-7908T-257 Sailors assigned to the air department aboard the aircraft carrier USS George H.W. Bush (CVN 77) prepare to lift a Sailor on a stretcher during a mass casualty drill on one of the ship's elevators
aboard uss george h. w. bush (cvn-77)
US Navy 091201-N-8913A-060 Aviation Boatswain's Mates (Handling) Airmen Fredrick Stoneham and David Bellgarde participate in a flight deck fire fighting drill
aviation boatswain's matepeople
US Navy 030718-N-0000X-002 Rear Adm. John W. Townes III, Vice Commander, Naval Education and Training Command speaks to guests at the dedication of Navy One
militaryvehicle
US Navy 100316-N-9793B-022 Quartermaster Seaman Ryan P. Hall, right, watches Quartermaster 2nd Class Paulino Martinez chart a course aboard the aircraft carrier USS George H.W. Bush (CVN 77)
bridge of the uss george h. w. bush (cvn-77)
US Navy 100324-N-6509M-016 Aerographer's Mate Airman Apprentice Dante J. Blesoch prepares to release a weather balloon o analyze atmospheric pressure and temperature
aboard uss george h. w. bush (cvn-77)aerographer's mate
US Navy 100521-N-8913A-003 Aircraft assigned line the flight deck of the aircraft carrier USS George H.W. Bush (CVN 77)
helicopter sea combat squadron 9 (united states navy)vehicle
US Navy 100522-N-3885H-061 Sailors assigned to Strike Fighter Squadron (VFA) 87 talk on the flight deck before flight operations aboard the aircraft carrier USS George H.W. Bush (CVN 77)
aboard uss george h. w. bush (cvn-77)military
US Navy 100421-N-3885H-153 Aviation Boatswain's Mate (Equipment) Airman Andricio Stinson waits for an aircraft to land aboard the aircraft carrier USS George H.W. Bush (CVN 77)
aviation boatswain's mateequipment
US Navy 120204-N-WL435-122 Chief of Naval Operations (CNO) Adm. Jonathan Greenert has lunch with the crew aboard the amphibious assault ship USS Wa
jonathan w. greenert in 2012kitchen
US Navy 120208-N-TU894-017 Air-Traffic Controller 1st Class Justin S. Brown tracks incoming aircraft from the carrier air traffic control center ab
aboard uss george h. w. bush (cvn-77)trackball
US Navy http-www.navy.mil-management-photodb-photos-100604-N-3885H-117 Guests aboard the aircraft carrier USS George H.W. Bush (CVN 77) salute as the ship's color guard parades the colors
peoplegroup
US Navy 111004-N-MU720-067 Chief of Naval Operations (CNO) Adm. Jonathan Greenert with his counterpart, Adm. Masahiko Sugimoto, greets an officer o
jonathan w. greenert in 2011army
USS George H.W. Bush (CVN 77) 140816-N-MW819-122 (14994725115)
militaryvehicle
USS George H.W. Bush (CVN 77) George H.W. Bush is supporting maritime security operations and theater security cooperation efforts in the U.S. 5th Fleet area of responsibility. (14356440482)
lightdark
US Navy 111019-N-QL471-572 Capt. Brian E. Luther, commanding officer of the aircraft carrier USS George H.W. Bush (CVN 77), right, and Operations S
aircraftvehicle
USS Missouri Memorial Association commemorates 68th anniversary of the end of World War II, unveils statue of Fleet Adm. Chester W. Nimitz 130902-N-PJ759-213
celebritiespeople
Saxon Warrior is a United States and United Kingdom co-hosted carrier strike group exercise that demonstrates interoperability and capability to respond to crises and deter potential threats. (36048031540)
vehiclesea
US Navy 071015-N-8704K-039 Adm. Jonathan Greenert, commander of Fleet Forces Command, shakes hands with crewmembers aboard the Military Sealift Command hospital ship USNS Comfort (T-AH 20)
handshakes involving the militarynaval station norfolk
US Navy 071015-N-8704K-076 Adm. Jonathan Greenert, commander of Fleet Forces Command, shakes hands with Sailors aboard the Military Sealift Command hospital ship USNS Comfort (T-AH 20)
handshakes involving the militarynaval station norfolk
US Navy 071022-N-2653P-157 Daniel Murphy, father of Navy SEAL Lt. Michael Murphy, stands as President George W. Bush delivers his remarks during the Medal of Honor ceremony at the White House
medal of honor presentation ceremony for michael p. murphydan murphy
US Navy 100925-N-7908T-045 Operations Specialist Seaman Christopher Rodriquez, assigned to the operations department of the aircraft carrier USS Ge
aboard uss george h. w. bush (cvn-77)people
Saxon Warrior is a United States and United Kingdom co-hosted carrier strike group exercise that demonstrates interoperability and capability to respond to crises and deter potential threats. (35637144973)
cloudsblue
Jałowiec w Puszczy Bydgoskiej
springplants
Ullswater, England, Cumberland District, England, by John W. Casilear, 1867 - Museum of Fine Arts, Springfield, MA - DSC03893
self-published workwater
Sextant by E. & G. W. Blunt, New York, and Quadrant by David White Co. for the US Navy, c. 1930 - Museum of Science and Industry (Chicago) - DSC06418
self-published worksextant
St. Mary Assumption (Dwight, Nebraska) W wall window 5
self-published workarchitecture
Ul. Sławkowska w Krakowie
travelcity
USS George H.W. Bush (CVN 77) 140619-N-CS564-100 (14277913039)
militaryvehicle
US Navy 030621-N-7780X-003 Forward deployed soldiers assigned to the U.S. Army 887th Quartermaster Company contacted their loved ones via Video Tele Conferencing (VTC) provided by Navy Region South through special arrangement w
videoconferencingindoor
USS George H.W. Bush (CVN 77) 140630-N-CZ979-105 (14362429879)
militaryvehicle
US Navy 050617-N-5313A-071 Commandant of the Marine Corps, Gen. Michael Hagee, recognizes selected Marines for their sustained superior performance
handshakes involving the military26th marine expeditionary unit
US Navy 110516-N-XE109-071 Chief Hospital Corpsman Kelly M. Miller conducts training during a general quarters drill aboard USS George H.W. Bush (C
aboard uss george h. w. bush (cvn-77)hospital corpsmen
US Navy 101022-N-3737T-212 Aviation Structural Mechanic Airman Isabel Ruiz, assigned to Helicopter Maritime Strike Squadron (HSM) 70, cleans the ta
helicopter maritime strike squadron 70 (united states navy)aboard uss george h. w. bush (cvn-77)
US Navy 110710-N-TU894-005 The aircraft carrier USS George H.W. Bush (CVN 77) pulls into Khalifa Bin Salman, Bahrain for a scheduled port visit
vehicleboat
US Navy 110909-N-NB544-274 Rear Adm. Robert Girrier, left, and Capt. Thom Burke answer questions during a media availability after USS Ronald Reaga
september 2011 in californiauss ronald reagan (cvn-76)
US Navy 110908-N-XE109-085 Sailors aboard the aircraft carrier USS George H.W. Bush (CVN 77) move cargo off an aircraft elevator into the hangar b
uss george h. w. bush (cvn-77) underway replenishmentusns sacagawea (t-ake-2)
US Navy 090113-N-2984R-008 Rear Adm. Richard J. O'Hanlon looks on as Rear Adm.John W. Goodwin gives his final remarks and reading of orders during a change of command ceremony
change of command ceremonies of the united states navychambers field
US Navy 100227-N-9116S-036 A Sailor conducts a maintenance check on the flight deck sprinklers aboard the aircraft carrier USS George H.W. Bush (CVN 77)
ships with rainbowsvehicle
US Navy 120112-N-PW494-078 Rear Adm. Gregory M. Nosal passes through ceremonial sideboys during a change of command ceremony in which he relieved R
aboard uss george h. w. bush (cvn-77)sideboys with red carpets
USS George H.W. Bush (CVN 77) 140707-N-CZ979-007 (14417238339)
militaryvehicle
USS George H.W. Bush (CVN 77) 141016-N-MW819-075 (15582674635)
militaryvehicle
US Navy 111013-N-FC670-033 Chief of Naval Operations (CNO) Adm. Jonathan Greenert delivers the keynote speech at the Naval Energy Forum at the Rona
jonathan w. greenert in 2011d.c.,
US Navy 111013-N-FC670-049 Chief of Naval Operations (CNO) Adm. Jonathan Greenert delivers the keynote remarks at the Naval Energy Forum at the Ron
jonathan w. greenert in 2011d.c.,
US Navy 111013-N-FC670-050 Chief of Naval Operations (CNO) Adm. Jonathan Greenert delivers the keynote speech at the Naval Energy Forum at the Rona
jonathan w. greenert in 2011d.c.,
US Navy 111029-N-FC670-436 Chief of Naval Operations (CNO) Adm. Jonathan Greenert greets a Sailor aboard the Virginia-class attack submarine USS C
watership
USS Missouri Memorial Association commemorates 68th anniversary of the end of World War II, unveils statue of Fleet Adm. Chester W. Nimitz 130902-N-PJ759-027
celebritiespeople
USS Missouri Memorial Association commemorates 68th anniversary of the end of World War II, unveils statue of Fleet Adm. Chester W. Nimitz 130902-N-PJ759-143
2013 in pearl harborpacific fleet band
U.S. Sailors prepare to move aircraft into the hangar bay aboard the aircraft carrier USS George H.W. Bush (CVN 77) June 30, 2014, in the Persian Gulf 140630-N-MU440-035
militaryvehicle
U.S. Sailors transport a wounded Sailor to the medical department June 27, 2014, during a general quarters drill on the flight deck of the aircraft carrier USS George H.W. Bush (CVN 77) in the Persian Gulf 140627-N-CZ979-071
uss george h. w. bush (cvn-77)
Flickr - Official U.S. Navy Imagery - The Superintendent, SECNAV and CNO salute and pay respect during the singing of the Irish and U.S. national anthems. (1)
jonathan w. greenert in 2012emerald isle classic 2012
170705-N-FE442-047 (35792110226)
night shotnight
170820-N-NG136-202 (36317605740)
aircraftvehicle
John W. Bill Goodwin
official portrait photographs of rear admirals of the united states navymen looking at viewer
Curtiss P-40Fs near Moore AAF 1943
militaryvehicle
Quercus rubra. The tree was found at the Lewis W. Barton Arboretum and Nature Preserve at Medford Leas.
foresttree
A picture of Carya tomentosa. The tree was found at the Lewis W. Barton Arboretum and Nature Preserve at Medford Leas.
foresttree
Elm Argid Sawfly (Argidae, Arge scapularis (Klug)) USA, AR, Montgomery Co.: Ouachita 34.611°N 93.778°W 30.V.2004 J.C. Abbott #2038 UTIC 201573
arthropodinsects
20181216_101908_jaracza_street_lodz_december_2018
citytown
Jefferson Memorial B W (206712331)
architecturecity
20190204_153405_Park_Staromiejski_w_Łodzi_february_2019
self-published workpages with maps
Saxon Warrior is a United States and United Kingdom co-hosted carrier strike group exercise that demonstrates interoperability and capability to respond to crises and deter potential threats. (36307598091)
boatsea
Yale Peabody Museum, Entomology Division Catalog #: YPM ENT 565968 Taxon: Catocala agitatrix Graeser (ventral) Family: Erebidae Taxon Remarks: Animals and Plants: Invertebrates - Insects Collector: W.
wildlifeanimals
Original caption: "No. 27. Nest and four eggs of Blue-gray Gnatcatcher in elm tree."
animalsbird
Bangladesh. Sylhet Div. Lowacherra Forest, LOW mark: nr W 553, <a href="http://nymphalidae.utu.fi/story.php?code=EW25-18" rel="nofollow">see in our database</a>
butterflyanimals
Image title: Walruses on waves Image from Public domain images website, http://www.public-domain-image.com/full-image/fauna-animals-public-domain-images-pictures/walrus-public-domain-images-pictures/w
animalsmammals
Girl baby girl party
princessfamily
Były cmentarz przy ul. Grunwaldzkiej w Gdańsku
greentree
US Navy 110129-N-3885H-158 USS George H.W. Bush (CVN 77) is underway in the Atlantic Ocean
vehiclesea
Ul. Św. Marka w Krakowie 02
travelcity
Ul. Kurniki w Krakowie 02
vehiclecity
Ulica Jana z Kolna w Gdańsku i Konstal 105Na
self-published workvehicle
Platte, South Dakota- W side Main between 4 and 5 2
self-published workplatte south dakota
Tablica upamiętniająca pobyt Napoleona Bonaparte w Toruniu
self-published workcc-zero
St. Anthony church (Cedar Rapids, Nebraska) W window 2 from front
self-published worksymmetry
St. Anthony church (Cedar Rapids, Nebraska) W window 5 from front
self-published worksymmetry
12001 - 12100 of 33,596 Next page
/ 336