17 Free Photos of 130 Ad

cc-zerofiles uploaded by daderotcc-pd-markauthor died more than 100 years ago public domain imageselectronic attack squadron 130 (united states navy)ad-5q (ea-1f) skyraidermilitaryvehicleaircraftaviation
Douglas AD-5W Skyraider of VAW-13 Det.N in flight, 1960
militaryvehicle
Douglas AD-5Q Skyraider of VAW-13 Det.L lands aboard USS Hancock (CVA-19), in 1962
aboard uss hancock (cv-19)landing signal officer
Douglas AD-5W Skyraider of VAW-13 Det.N lands on USS Hornet (CVS-12), in 1960
militaryvehicle
Capital from a pilaster, Roman, Imperial period, AD 130-190, marble - Fitchburg Art Museum - DSC08654
ancient roman art in the fitchburg art museumself-published work
Periander as a Greek scholar, Roman, head 130-140 AD, statue 1st century AD, base 140-150 AD from a sarcophagus with Nereids bearing the arms of Achilles, marble - Galleria Borghese - Rome, Italy - DDSC04884
self-published workcc-pd-mark
Periander as a Greek scholar, Roman, head 130-140 AD, statue 1st century AD, base 140-150 AD from a sarcophagus with Nereids bearing the arms of Achilles, marble - Galleria Borghese - Rome, Italy - DDSC04883
self-published workcc-pd-mark
Periander as a Greek scholar, Roman, head 130-140 AD, statue 1st century AD, base 140-150 AD from a sarcophagus with Nereids bearing the arms of Achilles, marble - Galleria Borghese - Rome, Italy - DSC04882
self-published workcc-pd-mark
EA-1F on cat USS Oriskany 1965
monochromevehicle
Father and son, Roman, 130-140 AD, marble - Galleria Borghese - Rome, Italy - DSC04992
self-published workcc-pd-mark
EA-1F Skyraider of VAW-13 Det.63 of approaches USS Kitty Hawk (CVA-63), circa in 1968 (NNAM.1996.253.2285)
militaryaircraft
Cylindrical jar with cobras spitting ankhs, Nubia, Ballana, Cemetery B, tomb 130, Meroitic Phase III, 200-250 AD, ceramic, paint - Oriental Institute Museum, University of Chicago - DSC08059
self-published workcc-zero
Altar sacred to Isis, S 1526, Roman, 130-170 AD, marble - Musei Capitolini - Rome, Italy - DSC06154
self-published workcc-pd-mark
Leaning satyr, S 739, Roman, c. 130 AD, marble, after original by Praxiteles, 4th century BC - Musei Capitolini - Rome, Italy - DSC05979
self-published workcc-pd-mark
Mummy portrait of a distinguished woman, Egypt, Fayum, c. 130 AD, H 2197 - Martin von Wagner Museum - Würzburg, Germany - DSC05329
self-published workcc-pd-mark
Antinous
photographystatues
EA-1F VAW-13 HMS Victorious 1963
historicalhistory
Laid up destroyers at San Diego in 1922
historicalhistory
1 - 17 of 17
/ 1