4,972 Free Photos of 68

cc-zeroaboard uss nimitz (cvn-68)photographs by leonhard lenzvehicletownmilitaryaircraftnavyarchitecturepages with maps
Neuburger Strasse 68 Passau
villagetown
Sand im Getriebe protest 2019 final demonstration 68
self-published workcc-zero
High-resolution computed tomograph of a normal thorax, sagittal plane (68)
self-published workcc-zero
High-resolution computed tomograph of a normal thorax, axial plane (68)
self-published workcc-zero
Lens - Dijon (21-02-2021) 68
sportgame
Seebrücke demonstration Berlin 2020-07-25 68
self-published workcc-zero
Airpower over USS Nimitz DVIDS256107
militaryvehicle
US Navy 030425-N-1577S-001 Airman Lorena Tiscareno from Mesa, Ariz., refuels an F-18
aboard uss nimitz (cvn-68)people
US Navy 110815-N-YM590-047 Sailors from the VBSS team clean weapons
people with m9 pistoluss anzio (cg-68)
US Navy 100129-N-3327M-049 A helicopter from military sealift command conducts and underway replenishment
aboard uss nimitz (cvn-68)n330kw (aircraft)
USS Anzio sailors play volleyball 120919-N-NL541-005
sports daysport
Naval Station Everett Feds Feed Families 140625-N-MM360-018
naval station everettuss nimitz (cvn-68)
Bdg Gdanska68 2 7-2015
travelcity
Anticolonial March Berlin 2019 Rojava block 68
anticolonial march berlin 2019 rojava blockself-published work
Geibelstraße 68-74
self-published workcc-zero
FridaysForFuture protest Berlin 2021-04-29 68
self-published workcc-zero
JASDF UH-60J ashiya 20161009 143403
militaryvehicle
Lympstone 2020-01-19 (68)
villagetown
20200730Saarbrücker_Straße_68_Brebach
architecturecity
Harlequin - porcelain made in England at the Bow factory in East London, about 1765-68 - Museum of Villa Pignatelli in Naples (45726462022)
villa pignatelli (naples) - interiorsshopping
US Navy 070614-N-6326B-058 Aviation Boatswain's Mate (Fuel) Airman Raynelle Brown attaches a fuel nozzle to an SH-60F Seahawk helicopter aboard nuclear-powered aircraft carrier USS Nimitz (CVN 68)
protective clothingaircraft fueling
US Navy 100216-N-3038W-546 Capt. Scott Conn, deputy commander of Carrier Air Wing (CVW) 11, makes his 1000th career arrested landing. CVW-11 is embarked aboard the aircraft carrier USS Nimitz (CVN 68)
militaryaircraft
Rückingen, An der Wasserburg 26
waterriver
Protest at Autogipfel in Berlin 2020-05-05 68
self-published workpavement
Unteilbar demonstration Berlin 2019-10-13 68
self-published workstadium
2018-05-10 Sächsisches Eisenbahnmuseum Chemnitz-Hilbersdorf, 68
self-published workcc-zero
Child with pear and hamper - porcelain made in England at the Bow factory in East London, about 1765-68 - Museum of Villa Pignatelli in Naples (45076450661)
villa pignatelli (naples) - interiors
Felsenburg Rißweg 68 Loschwitz 4
architecturetown
160623-N-ZZ999-001 (27347268554)
underwaterwater
FridaysForFuture protest Berlin 2020-04-24 68
self-published workarchitecture
Friedrichsdorf, Hugenottenstraße 68
villageroof
Front of the Seebrücke demonstration Berlin 06-07-2019 68
self-published workcc-zero
Berlin gegen 13 demonstration 68
self-published workpages with maps
Ende Gelände AKK finger 2020-09-26 68
self-published workarmy
Ende Gelände Orange finger 2020-09-26 68
self-published workcelebrities
Frankfurt, Mendelssohnstrasse 68-72
architecturetown
FridaysForFuture protest Berlin 2020-10-16 68
self-published workarchitecture
Chapelle Notre-Dame de Polignan 68
self-published workcc-zero
Brussels-Public domain event, 26 May 2018 (68)
self-published workinterior
Maulbach forest after tree cuttings 2020-10-08 68
agriculturefield
Mietenwahnsinn demonstration Berlin 2021-05-23 68
self-published workpavement
USNS Rainier conducts replenishment-at-sea. (8721195568)
boatsea
US Navy 110722-N-TY225-318 A visit, board, search and seizure team investigates a suspected pirate skiff
piracy in somaliaboat
US Navy 091112-N-3038W-352 Aviation Ordnancemen upload a laser-guided bomb to an F-A-18C Hornet
aboard uss nimitz (cvn-68)aviation ordnanceman
Flickr - Official U.S. Navy Imagery - USS Dwight D. Eisenhower conducts a replenishment at sea. (1)
vehiclesea
US Navy 040824-N-9319H-024 A plane captain prepares an F-A-18C Hornet assigned to Strike Fighter Squadron Nine Four (VFA-94) for a full day of flight operations aboard the aircraft carrier USS Nimitz (CVN 68)
militaryvehicle
US Navy 090225-N-3946H-038 An F-A-18C Hornet launches off the flight deck of USS Nimitz (CVN 68)
militaryvehicle
US Navy 090906-N-6814F-055 he guided-missile cruiser USS Anzio (CG 68) receives fuel and supplies from the Military Sealift Command fleet replenishment oiler USNS John Lenthall (T-AO 189) during an underway replenishment
boatship
US Navy 091226-N-8421M-070 The Most Rev. Timothy Broglio, Fr. James Danner and Fr. Frank Foley celebrate Catholic Mass aboard USS Nimitz (CVN 68)
red chasublescelebrities
US Navy 100120-N-3589B-023 A Sailor directs a C-2A greyhound assigned to the Providers of Carrier Logistics Support Squadron (VRC) 30 aboard the aircraft carrier USS Nimitz (CVN 68)
militaryaircraft
US Navy 100125-N-8421M-027 An F-A-18E Super Hornet assigned to the Tophatters of Strike Fighter Squadron (VFA) 14 prepares to land aboard the aircraft carrier USS Nimitz (CVN 68)
militaryvehicle
US Navy 100126-N-3038W-132 Aviation Structural Mechanic 2nd Class Thida Kun performs maintenance on the nose landing gear of an EA-6B Prowler aboard the aircraft carrier USS Nimitz (CVN 68)
retractable undercarriagespeople
US Navy 030316-N-6536T-003 The fast combat support ship USS Bridge (AOE 10) transfers MK-84 Joint Direct Attack Munitions (JDAM) bombs to the aircraft carrier USS Nimitz (CVN 68)
shipsea
US Navy 030327-N-2385R-002 USS Nimitz (CVN 68) and Carrier Air Wing Eleven (CVW-11) personnel perform a Foreign Object Damage (FOD) walkdown on the ship's flight deck
vehiclenavy
US Navy 070807-N-9760Z-002 An F-A-18C Hornet, assigned to the Sunliner's of Strike Fighter Squadron (VFA) 81, lands on the flight deck of the nuclear-powered aircraft carrier USS Nimitz (CVN 68)
militaryvehicle
US Navy 030527-N-2385R-001 R. Lee Ermey, host of the popular History Channel program Mail Call, observes flight operations aboard USS Nimitz
f/a-18f super hornet on flight decksuss nimitz (cvn-68) flight deck
US Navy 030625-N-2385R-001 A flight deck handler directs an S-3B Viking onto one of the four steam powered catapults on the flight deck aboard USS Nimitz (CVN 68)
militaryvehicle
US Navy 061213-N-8158F-025 An F-A-18F Super Hornet assigned to the Black Aces of Strike Fighter Squadron Four One (VFA-41) launches from the flight deck aboard the nuclear-powered aircraft carrier USS Nimitz (CVN 68)
militaryaircraft
US Navy 100704-N-4053P-062 Sailors and their families watch a fireworks display over San Diego Bay aboard the aircraft carrier USS Nimitz (CVN 68)
californianight
US Navy 090731-N-2918M-017 Lt. j.g. David helps San Diego Girl Scouts prepare for Operation Thin Mint as the aircraft carrier USS Nimitz (CVN 68) prepares to depart for a scheduled deployment to the western Pacific Ocean
girl scout cookiecelebrities
US Navy 090917-N-3038W-110 Air department Sailors prepare to launch a C-2A Greyhound aircraft assigned to the Providers of Carrier Logistics Support Squadron (VRC) 30 aboard the aircraft carrier USS Nimitz (CVN 68)
fleet logistics support squadron 30 (united states navy)aboard uss nimitz (cvn-68)
US Navy 100326-N-7939W-109 Machinist's Mate 1st Class Jay Hinton mans the rails with his son and other Nimitz Sailors on the flight deck of the aircraft carrier USS Nimitz (CVN 68) as the ship transits into its homeport at Nava
manning the rail on uss nimitz (cvn-68)people
US Navy 070402-N-8273J-082 Aviation Boatswain's Mate (Handling) Airman Colin Navarne says goodbye to his girlfriend prior to nuclear-powered aircraft carrier USS Nimitz (CVN 68) departing Naval Air Station North Island
aboard uss nimitz (cvn-68)people
US Navy 070930-N-7128A-050 Sailors man the rails of nuclear-powered aircraft carrier USS Nimitz (CVN 68) as she enters San Diego Bay
skylinecity
US Navy 080213-N-6326B-128 Culinary Specialist 3rd Class Catawnya Bales, assigned to the aircraft carrier USS Nimitz (CVN 68), reads a display while touring the grounds of the Nagasaki Atomic Bomb Museum during a port visit to
city lifepeople
US Navy 100130-N-3327M-235 An F-A-18C Hornet assigned to the Warhawks of Strike Fighter Squadron (VFA) 97, launches from the aircraft carrier USS Nimitz (CVN 68)
uss nimitz (cvn-68) flight deckf/a-18c hornet on flight decks
US Navy 060831-N-8158F-252 An F-A-18E Super Hornet assigned to the Fighting Redcocks of Strike Fighter Squadron Two Two (VFA-22) launches from the flight deck aboard the nuclear-powered aircraft carrier USS Nimitz (CVN 68)
f/a-18e super hornet on flight decksaboard uss nimitz (cvn-68)
National Gallery Ireland 68
self-published workcc-zero
Revolutionary 1st may demonstration Berlin 2021 68
self-published workletter
Port Deposit MD 68 S Main
villagetown
20190914Spitalstraße_Brebach2
sidewalktown
Bermuda (UK) photos number 68 dolphin airborne doing tricks for a trainer
self-published workwater
FridaysForFuture protest Berlin 13-12-2019 demonstration 68
self-published workcc-zero
Issy - Fleury, 3 September 2017 - 68
self-published workanais atila
US Navy 040821-N-8158F-004 Crew members participate in a mass casualty drill aboard the flight deck of the nuclear
aboard uss nimitz (cvn-68)group
US Navy 091123-N-8960W-008 viation Structural Mechanic 3rd Class Jessica Rice prepares aircraft parts for inspection
aboard uss nimitz (cvn-68)
MH-60R Sea Hawk helicopter 131026-N-UV347-309
militaryvehicle
Leonard Lyon, Lisa Franchetti and Curtis Larson 180514-N-VV353-057 (40301804090)
lisa m. franchettictf 68
F-35C Lightning II 141104-N-DC018-275
general views of uss nimitz (cvn-68)vehicle
F-35C Lightning II at-sea trials 141104-N-ZZ999-006
aircraftvehicle
USS Nimitz action 150922-N-QY316-045
uss nimitz (cvn-68)people
USS Nimitz transits the Arabian Gulf. (37182873081)
vehicleboat
Gloeden, Wilhelm von (1856-1931) - n. 2851 - da - Amore e arte, p. 68
men and boys by wilhelm von gloedenamphoras shown in art photographs
Fürstenstraße 68 Chemnitz
architecturetown
Pride demonstration Berlin 2020-06-27 68
self-published workcity
Start of the Coal and Boat demonstration 2019 68
vehiclewater
Sossenheim, Alt-Sossenheim 68
architecturevillage
Реконструкция поликлиники № 68 в Сестрорецке
architecturetown
Entraînement RC Lens - 19 juin 2018 68
sportgame
Paseo de los Olímpicos Rosario 2019 68
self-published workcc-zero
Seebach Leihgraben Bachgasse 68 Tümpel Sellerie
foresttree
Mühlhausen-Thüringen 68
images with annotationspages with maps
Lens-Niort (21-12-2019) 68
sportfield
RC Lens - AJ Auxerre (09-03-2019) 68
self-published workcc-zero
RC Lens - SM Caen (22-02-2020) 68
self-published workcc-zero
RC Lens - AS Béziers (04-01-2019) 68
grassfield
RC Lens - FC Metz (09-02-2019) 68
self-published workcc-zero
Airpower over USS Nimitz DVIDS256111
militaryaircraft
US Navy 031015-N-2385R-005 Seaman Juan Alicianieves from Bonce, Puerto Rico, stands the lee helmsman watch
aboard uss nimitz (cvn-68)
US Navy 061214-N-0890S-002 An F-A-18 Hornet assigned to the
strike fighter squadron 81 (united states navy)aboard uss nimitz (cvn-68)
1801 - 1900 of 4,972 Next page
/ 50