21.821 Kostenlose Bilder von Oper

bootverkehrsmittelwassermarinemeerschiffmilitärgruppelichtschiff
US Navy 060828-N-7130B-279 High above the flight deck aboard the Nimitz-class aircraft carrier USS Ronald Reagan (CVN 76), members of the ships Air Department watch as aircraft prepare to land during flight operations
US Navy 070426-N-4163T-290 Chief Special Warfare Operator Larry E. Summerfield II, attached to the U.S. Navy Parachute Team, demonstrates proper parachute packing procedures to members of the Navy's Delayed Entry Program
gruppe
US Navy 111029-N-FC670-436 Chief of Naval Operations (CNO) Adm. Jonathan Greenert greets a Sailor aboard the Virginia-class attack submarine USS C
wasserschiff
US Navy 110412-N-ZB612-065 Chief of Naval Operations (CNO) Adm. Gary Roughead salutes Israel Naval Forces sailors after meeting with Vice Adm. Eli
US Navy 110414-N-7293M-413 Operations Specialist 3rd Class David Wolery, assigned to the visit board, search and seizure (VBSS) team from the amphi
marine
US Navy 110509-N-DR144-578 Operations Specialist 3rd Class David Ayala talks with other watch standers on a sound-powered telephone while standing
US Navy 110318-N-SB672-562 Sailors speak with Japanese men about providing additional supplies during a humanitarian assistance mission
US Navy 110325-N-ZB612-008 Chief of Naval Operations (CNO) Adm. Gary Roughead speaks with retired Vice Adm. Daniel Oliver, president of the Naval P
US Navy 110329-N-5538K-217 A CH-46E Sea Knight helicopter carrying humanitarian assistance supplies takes off from the forward-deployed amphibious
US Navy 100921-M-6740B-304 U.S. Navy Capt. Thomas M. Negus, commodore of Operation Continuing Promise 2010, visits with local Nicaraguan children a
US Navy 110315-N-IC111-117 Naval Air Crewman 2nd Class Zack DelCorte ands bottled water to a Japanese citizen
menschen
U.S. Sailors fight a simulated fire during a general quarters drill in the hangar bay of the aircraft carrier USS Harry S. Truman (CVN 75) March 8, 2014, in the Gulf of Oman 140308-N-ZG705-433
U.S. Sailors fight a simulated fire during a general quarters drill in the hangar bay of the aircraft carrier USS Harry S. Truman (CVN 75) March 8, 2014, in the Gulf of Oman 140308-N-ZG705-349
U.S. Sailors fight a simulated fire during a general quarters drill in the hangar bay of the aircraft carrier USS Harry S. Truman (CVN 75) March 8, 2014, in the Gulf of Oman 140308-N-ZG705-415
USS Ronald Reagan flight deck operations 130713-N-HT107-184
verkehrsmittelmilitär
A-7E VA-94 on cat of USS Enterprise (CVN-65) 1988
verkehrsmittelmilitär
F-14B VF-102 AIM-54 and AIM-9
flugzeugmilitär
Sailor fabricates an arresting gear cover at sea. (9554193131)
Flickr - Official U.S. Navy Imagery - The SECNAV observes nighttime flight operations.
lichtnacht
US Navy 090424-N-8273J-122 Chief of Naval Operations (CNO) Adm. Gary Roughead speaks with and answers questions from students in the Naval Junior ROTC program at Annapolis High School
US Navy 070604-N-0989H-041 Guatemalan sailors and 0fficer cadets practice tying knots during small boat operations subject matter exchanges on board High Speed Vessel (HSV) 2 Swift
militär
US Navy 070608-N-0989H-044 Guatemalan sailors conducts bumper drills along side High Speed Vessel (HSV) 2 Swift during small boat operations subject matter exchanges
US Navy 070620-N-3857R-001 Personnel Specialist 3rd Class Ray Guedry, of Naval Mobile Construction Battalion (NMCB) 1, splices a communications wire in the ant farm of the battalion's forward operating base (FOB) during Operati
US Navy 091221-N-4482V-005 Rear Adm. Joseph Kilkenny, commander of Naval Education and Training, and his senior staff, listen to Lt. j.g. Justin Guernsey explain the operation of the control panel
US Navy 091223-N-9898L-006 Aviation Electronics Technician 2nd Class Alejandro Benavides renders honors as Aviation Structural Mechanic 1st Class Andrew Johnson lowers the American flag outside of the Navy Operational Support C
winterschnee
US Navy 091225-N-8421M-103 t. Jon Sunderland dresses in a Santa suite while directing aircraft operations aboard the aircraft carrier USS Nimitz (CVN 68) Christmas Day
marine
Image title: Old photo of bison transplanting operation Image from Public domain images website, http://www.public-domain-image.com/full-image/vintage-photography-public-domain-images-pictures/old-pho
säugetieretiere
Handmade scarf traditional
kindertanz
Outfit tradition sitting
kindertanz
Der junge Lord (Henze) playbill
Check the computer connection
technologieweltraum
Rheiderland include a harvest tractors
landwirtschaftbauernhof
2021-02-20-Tohoku-Shinkansen-operation-information-at-Tokyo-Station-02
VolkerRail 203-1 Tom, 203-3 Spike & 203-2 Jerry pic1
verkehrsmittelpersonenzug
Veolia 6760 te Heerlen station
verkehrsmittel
MARSOF Afghanistan-15
Defense.gov News Photo 110921-N-GZ277-053 - The guided missile destroyer USS Stockdale DDG 106 leads a formation of ships with the Carl Vinson Carrier Strike Group as they conduct operations in
schiffboot
F3H-2M of VF-61 on USS Saratoga (CVA-60) 1957
verkehrsmittelmilitär
F-4J Phantom II of VF-33 in flight in 1970
US Navy 040423-N-6234S-082 The mine warfare ship USS Raven (MHC 61) conducts local operations in the North Arabian Gulf
bootmeer
U.S. Navy Adm. Jonathan Greenert, foreground, second from left, the chief of Naval operations, watches from the sidelines with a U.S. Naval Academy alumnus as the Midshipmen run onto the football field to play 120901-N-WL435-490
stadion
US Navy 070501-N-0696M-079 Chief of Naval Operations (CNO) Adm. Mike Mullen speaks with Timothy B. Clark, Editor and President of Government Executive magazine during a leadership breakfast at the National Press Club
vereinigte staatenlicht
US Navy 061115-N-0490C-006 Aviation Warfare Systems Operator 2nd Class Matthew J. Gensler, assigned to the Nightdippers of Helicopter Anti-submarine Squadron Five (HS-5), verifies his receipt for his procurement of fuel
menschen
US Navy 060522-N-7526R-001 Operations Specialist 2nd Class Gil Diaz concentrates on a radar screen as he communicates with an aircraft during his air defense weapons coordinator (ADWC) watch, in the Combat Direction Center (CDC
US Navy 070307-N-6710M-004 A Landing Craft Utility (LCU) prepares to enter the well deck of amphibious transport dock ship USS Tortuga (LSD 46) while conducting amphibious operations
wasserboot
USS Carl Vinson supports Operation Inherent Resolve 141104-N-TP834-377
dunkellicht
US Navy 070822-N-8923M-142 Machinery Repairman 2nd Class Patrick Koenig machines metal on a lathe in the machine shop of Nimitz-class aircraft carrier USS Harry S. Truman (CVN 75)
US Navy 071211-N-9623R-003 Seabees from Naval Mobile Construction Battalion (NMCB) 17 load a patient into a UH-60 Blackhawk medical evacuation helicopter
US Navy 071213-N-8273J-109 Chief of Naval Operations (CNO) Adm. Gary Roughead appears before the House Armed Services Committee to give testimony and answer questions concerning the unified maritime strategy
US Navy 070719-N-0696M-686 Chief of Naval Operations (CNO) Adm. Mike Mullen speaks with the crew aboard amphibious assault ship USS Boxer (LHD 4)
dunkel
US Navy 070724-N-6247M-001 Aerographers Mate 3rd Class Daniel Miles and Aerographers Mate 1st Class Jessica Martin take weather observations from the rooftop of the operations building at Naval Air Station Whidbey Island
US Navy 070921-N-0696M-432 Chief of Naval Operations (CNO) Adm. Mike Mullen attends a frocking ceremony for three new chief petty officers assigned to the Naval Post Graduate School (NPS)
gruppe
US Navy 080701-N-0640K-191 Aviation Warfare Systems Operator 2nd Class Jeremy Thomas, a native of Warren, Ohio, waves to citizens of the Municipality of Balasan, Philippines after delivering hygiene items, water and tents to th
menschen
US Navy 080712-N-9134V-200 The visit, board, search and seizure team assigned to the amphibious dock landing ship USS Carter Hall (LSD 50) conducts maritime interdiction operations
verkehrsmittelwasser
US Navy 080726-N-3392P-162 The visit, board, search and seizure teams assigned to the amphibious dock landing ship USS Carter Hall (LSD 50) conduct approach operations
verkehrsmittelwasser
US Navy 070618-N-7128A-041 Aviation Boatswain's Mate (Equipment) 1st Class Juan Salcedo signals the shooter after the catapult's final check that a jet is clear to launch during flight operations aboard nuclear-powered aircraft
US Navy 070619-N-3857R-004 Personnel Serviceman 3rd Class Ray Guedry assigned to Naval Mobile Construction Battalion (NMCB) 1 pull communications wire across the battalion's forward operating base at Camp Shelby
militärarmee
US Navy 081105-N-9520G-014 Operations Specialist 3rd Class Cindy R. Skinner, from Madison Heights, Mich., uses a telescopic alidade to make reports on surface contacts aboard the amphibious assault ship USS Essex (LHD 2)
US Navy 081103-N-2183K-058 A CH-53E Super Stallion helicopter descends to the flight deck during operations to disembark Marines
verkehrsmittelboot
US Navy 080216-N-8273J-079 Chief of Naval Operations (CNO) Adm. Gary Roughead walks to the podium before presenting the Black Engineer of the Year Award for Career Achievement in Government
dunkellicht
US Navy 080607-N-9689V-011 Cmdr. Kenneth Kubis, director of surgical services aboard the Military Sealift Command hospital ship USNS Mercy (T-AH 19), uses an operating microscope
US Navy 110523-N-ZB612-008 Chief of Naval Operations (CNO) Adm. Gary Roughead speaks with service members stationed at the U.S. Embassy in Madrid
jung
US Navy 110601-N-RC734-164 Marines disembark Landing Craft Utility (LCU) 1648 during stern gate marriage operations aboard USS Comstock (LSD 45)
schiffboot
US Navy 110321-N-0864H-310 Sailors arrange pallets on the main deck aboard the U.S. 7th Fleet command ship USS Blue Ridge (LCC 19) during a vertica
menschenstadt
US Navy 110321-N-IC111-206 Naval Air Crewman 2nd Class Chris Tautkus gestures to a Japanese child to return his helmet
US Navy 110319-N-DM338-030 Sailors and Marines load food and humanitarian supplies on the flight deck of the aircraft carrier USS Ronald Reagan (CV
US Navy 110131-N-9643K-428 The amphibious assault ship USS Makin Island (LHD 8) returns to Naval Base San Diego after completing local operations
wasserboot
US Navy 110805-N-ZB612-042 Chief of Naval Operations (CNO) Adm. Gary Roughead renders honors during a welcoming ceremony to the Chilean naval headq
menschenchile
US Navy 110910-N-ZZ999-001 Secretary of the Navy (SECNAV) the Honorable Ray Mabus addresses reserve component Sailors at the Navy Operational Suppo
US Navy 110924-N-ZL585-111 Sailors from USS Constitution and various Navy Operational Support Centers near Springfield, Mass., march on the Avenue
prominentemenschen
US Navy 090928-N-6692A-054 Sailors and Marines observe the recovery of Landing Craft Utility 1631 during well deck operations aboard the amphibious dock landing ship USS Tortuga (LSD 46)
wasser
US Navy 090930-N-6692A-072 Sailors aboard the amphibious dock landing ship USS Tortuga (LSD 46) tend to a Marine Corps CH-53 Sea Stallion helicopter during flight operations
verkehrsmittelmilitär
US Navy 091108-N-9500T-152 Fire Controlman 3rd Class Lacey Robertson mans a .50-caliber machine gun on the fantail of the guided-missile cruiser USS Chosin (CG 65) as the ship conducts counter-piracy operations in the Gulf of A
US Navy 090327-N-2456S-001 The aircraft cattier USS Theodore Roosevelt (CVN 71) transits the Suez Canal after five months of operations in the U.S. 5th Fleet area of responsibility
stadtbild
US Navy 090720-N-7092S-397 Chief Gunner's Mate Joshua Tolleson discusses maritime interdiction operation techniques with Colombian sailors during a subject matter expert exchange aboard the guided-missile frigate USS Kauffman (
US Navy 090822-N-8273J-050 Chief of Naval Operations (CNO) Adm. Gary Roughead awards Enlisted Surface Warfare pins to six Sailors while aboard the guided-missile frigate USS Thatch (FFG 43)
marine
US Navy 090624-N-8273J-109 Chief of Naval Operations (CNO) Adm. Gary Roughead, presents Ramee Gregory with the Navy League Youth Medal during the 2009 annual Navy League Dinner in Philadelphia, Penn
menschen
US Navy 080219-N-6326B-027 Aviation Boatswain's Mate (Handling) 3rd Class Jerell Hurdle directs an F-A-18F Super Hornet to a during flight operations aboard the aircraft carrier USS Nimitz (CVN 68)
US Navy 080216-N-5476H-054 Lt. Cmdr. Andrew Bates operates the radar system control in the combat information center during a ballistic missile defense drill aboard the Ticonderoga-class guided-missile cruiser USS Lake Erie (CG
US Navy 100216-N-1522S-004 Sailors handle lines as the littoral combat ship USS Freedom (LCS 1) departs Naval Station Mayport for its first operational deployment
wasserboot
US Navy 100117-N-6410J-020 Sailors transfer food stores to feed the more than 700 civilians and Sailors aboard the Military Sealift Command hospital ship USNS Comfort (T-AH 20) who are participating in Operation Unified Respons
US Navy 100119-N-6676S-006 A U.S. Coast Guard HH-60J Jayhawk helicopter leaves the soccer field at the Killick Haitian Coast Guard Base to transport earthquake victims
US Navy 100120-N-3165S-084 Members of a Haiti village hold up a United States flag during a reconnaissance flight to assess the damage from the 6.1 magnitude aftershock
US Navy 100123-N-4774B-108 Sailors assigned to the guided-missile cruiser USS Normandy (CG 60) assess the feasibility of docking supply ships in a bay near the village of Petit Trou De Nippes, Haiti
wasser
US Navy 100204-N-2735T-020 Sailors assigned to the combat cargo division aboard the amphibious assault ship USS Nassau (LHA 4) transport a pallet of meals-ready-to-eat for relief operations in Haiti
mahlzeit
US Navy 100407-N-8273J-064 Chief of Naval Operations (CNO) Adm. Gary Roughead delivers remarks during a keel laying ceremony for an Egyptian navy fast missile craft
US Navy 100527-N-3136P-057 Two rigid-hull inflatable boats operated by the Spanish Navy transfer members of a visit, board, search and seizure team to the Military Sealift Command
bootmeer
US Navy 100421-N-4965F-372 Master-at-Arms 3rd Class William Landeros, assigned to Maritime Expeditionary Security Squadron (MSRON) 3, takes cover behind a vehicle at a simulated forward operating base
US Navy 100329-N-7058E-033 The littoral combat ship USS Freedom (LCS 1) passes beneath the Bridge of the Americas as it departs Panama City following a theater security cooperation port visit as part of operations in the U.S. 4
US Navy 050114-N-6363M-078 Chief of Naval Operations, Admiral Vern Clark, enjoys the company of USS Harry S. Truman (CVN 75) crew for lunch on the forward deployed nuclear powered aircraft carrier
essen
US Navy 051118-N-9866B-452 Chief Warrant Officer Kelvin Dickey radios down to pier operators to bring up the brow aboard amphibious assault ship USS Peleliu (LHA 5)
US Navy 070121-N-3038W-009 Tactical Action Officer (TAO), Lt. Josh Taylor, sits in the Combat Direction Center aboard the Nimitz-Class aircraft carrier USS John C. Stennis (CVN 74), during flight operations
US Navy 060104-N-2838C-001 Chief of Naval Operations (CNO) Admiral Mike Mullen walks through sideboys as honors are rendered. Admiral Mullen is aboard USS Theodore Roosevelt (CVN 71) for an overnight visit
menschengruppe
US Navy 050113-N-2757S-004 Chief of Naval Operations (CNO), Adm. Vern Clark, does the honors of awarding Fleet Marine Force warfare specialty pins to military members while visiting troops in the Middle East
menschen
US Navy 100827-N-2855B-069 Operation's Specialist 2nd Class Edward Earskin kisses his wife and 2-month-old daughter before boarding the amphibious assault ship USS Kearsarge (LHD 3)
US Navy 101104-N-1722W-151 A Sailor aboard the amphibious assault ship USS Boxer (LHD 4) guides a landing craft air cushion (LCAC) operated by Mari
licht
US Navy 100714-N-3885H-211 Former President George H.W. Bush watches flight operations aboard USS George H.W. Bush (CVN 77)
US Navy 100714-N-3885H-174 Former President George H.W. Bush watches flight operations aboard USS George H.W. Bush (CVN 77)
US Navy 100608-N-8913A-030 Sailors assigned to the aircraft carrier USS George H.W. Bush (CVN 77) perform a rigid-hull inflatable boat operation
verkehrsmittelwasser
US Navy 100728-N-7638K-253 Operations Specialist Seaman Thaddeus Hall, from Myrtle Beach, S.C., passes a box of supplies during an all hands working party aboard the Oliver Hazard Perry-class guided-missile frigate USS Taylor (
menschen
11601 - 11700 von 21.821 Nächste Seite
/ 219