16,330 Free Photos of Base

yokosuka naval base in the 2000svehiclecc-zero玄史生写真文庫boataircraftshipmilitarynavyaviation
US Navy 060831-N-3560G-010 Lt.jg Neil Ebuen of Naval Mobile Construction Battalion Four (NMCB-4) reviews the Operations and Intel Tracker
naval mobile construction battalion 4military
US Navy 061015-N-4953E-002 Boatswain's mates on board guided-missile destroyers USS Stethem (DDG 63) (left) and USS Fitzgerald (DDG 62) prepare to take in lines as the Stethem prepares to get underway from her homeport in
boatship
US Navy 100715-N-4047W-004 Cmdr. David Lott salutes the side boys at the conclusion of a change of command ceremony for the Los Angeles-class fast attack submarine
armynavy
US Navy 100811-N-3560G-001 Cmdr. David Bynum speaks about the lost of naval submarines during the month of Aug. throughout World War II during a special bell-tolling service at Joint Base Pearl Harbor-Hickam Submarine Memorial
memorial servicepearl harbor
US Navy 111207-N-RP435-872 Sailors assigned to Riverine Squadron (RIVRON) 2 get underway in riverine command boats
vehicleboat
US Navy 101027-N-7883G-048 Students from Basic Underwater Demolition-SEAL (BUD-S) class 286 participate in a surf passage training exercise at Nava
watersea
Flickr - Official U.S. Navy Imagery - USS Texas is moored in the state-of-the-art submarine magnetic silencing facility at Beckoning Point at Joint Base Pearl Harbor-Hickam during a ribbon cutting ceremony.
images from united states navy to checkuss texas (ssn-775) at pearl harbor
050116-N-4729H-146 Sailors from Naval Air Station Joint Reserve Base Willow Grove, Pa. hold a giant American flag in a National Football League pregame ceremony in Philadelphia between the Philadelphia Eagles and Minnes
women in the united states navycompetition
US Navy 050317-N-9866B-005 A fire fighting team works in the darkness to put out a simulated fire in the hanger bay of the amphibious assault ship USS Peleliu (LHA 5)
lightdark
US Navy 050606-N-9866B-039 Sailors man-the-rails as the amphibious dock landing ship USS Duluth (LPD 6) return after a schedule six-month deployment
boatship
US Navy 050606-N-9866B-047 A Sailor assigned to the amphibious dock landing ship USS Duluth (LPD 6) hugs his son after returning from a six-month deployment
celebritiesgroup
US Navy 050521-N-0295M-025 Air Force One taxis behind a F-16C Fighting Falcon belonging to the U.S. Air Force Air Demonstration Squadron, Thunderbirds, prior to takeoff from Andrews Air Force Base, Md., during the 2005 Joint Se
aircraftaviation
US Navy 050619-N-1464F-006 The Dutch submarine HNLMS Dolfijn (S 808) conducts a low-pressure blow during pre-underway checks in Taranto Naval Base Mar Grande
watership
US Navy 050628-N-3019M-001 A line handler directs as a World War II-vintage B-25 Mitchell medium bomber is lowered by crane to the pier after being transported via barge from Hickam Air Force Base to Ford Island
aircraftvehicle
US Navy 050716-N-0050T-002 Commanding Officer, USS Pearl Harbor (LSD 52), Cmdr. Jonathan Harden, says goodbye to his loved ones before his ship departs Naval Station San Diego
naval ship departures from naval base san diegoaboard uss pearl harbor (lsd-52)
US Navy 100119-N-5345W-042 Haitian citizens watch as Sailors and Marines assigned to the Bataan Amphibious Relief Mission begin to come ashore to set up an operating base at the New Hope Mission at Bonel, Haiti
celebritiespeople
US Navy 100119-N-5345W-146 Sailors assigned to Beach Master Unit (BMU) 2, part of the Bataan Amphibious Relief Mission, establish an operating base at New Hope Mission in Bonel, Haiti for U.S. Navy and Marine Corps humanitarian
aboard uss gunston hall (lsd-44)aboard uss bataan (lhd-5)
US Navy 090506-N-3038C-443 Navy Cryptologic Technicians 1st Class Eddie Phillips and Robert Zimmerman, both assigned to Navy Information Operations Command, Buckley Air Force Base, Aurora, Colo., help a Clyde Miller Elementary
cryptologic techniciandenver navy week
US Navy 090615-N-1229B-024 Aviation Electrician's Mate Senior Chief Gregory Sterling from Leesville, La. shakes hands with players from the Kitsap Bluejackets during military appreciation night for the Bluejackets
men with baseballspeople
US Navy 090822-N-8273J-246 Chief of Naval Operations (CNO) Adm. Gary Roughead, right, visits the Iraqi Navy patrol ship Fetah (701) with Cmdr. Ahmed Jasim, commanding officer of Umm Qasr Naval Base
peoplearmy
US Navy 090822-N-8273J-230 Chief of Naval Operations (CNO) Adm. Gary Roughead, right, visits the Iraqi Navy patrol ship Fetah (701) with Cmdr. Ahmed Jasim, commanding officer of Umm Qasr Naval Base
militaryarmy
US Navy 050909-N-2653P-003 Forward Deployable Preventive Medicine Unit (FDPMU) East, removes a Light Trap provided by the Centers for Disease Control (CDC) from a tent city area on board NAS JRB New Orleans
traps for flying insectsmosquito control
US Navy 051104-N-9866B-001 Store Keeper 2nd Class Eric Coleman prepares to make an announcement over the 1MC intercom while serving as Petty Officer of the Watch aboard the amphibious assault ship USS Peleliu (LHA 5)
ships moored at naval base san diegoaboard uss peleliu (lha-5)
US Navy 050108-N-9389D-063 Crew members gather on the flight deck during an abandon-ship drill held aboard the conventionally powered aircraft carrier USS Kitty Hawk (CV 63) while in port Yokosuka, Japan
aboard uss kitty hawk (cv-63)vehicle
US Navy 050302-N-9866B-001 Sailors watch the San Diego, Calif., skyline pass by them from inside the hanger bay aboard the amphibious assault ship USS Peleliu (LHA 5)
naval ship arrivals to naval base san diegoaboard uss peleliu (lha-5)
US Navy 070104-N-7883G-006 Culinary Specialist Seaman Rob Exler from Columbia, Md., grills pork chops in the aft galley aboard USS Kitty Hawk (CV 63)
pork chopinside
US Navy 060525-N-0000X-002 A standard missile - 2 (SM-2) is launched from the Pearl Harbor-based Aegis cruiser USS Lake Erie (CG 70) as part of a U.S. Navy missile defense demonstration
militarynavy
US Navy 060602-N-4953E-012 Senior Chief Boatswain's Mate Ronny Corpuz pipes off Chief Gas Turbine Systems Technician Timothy Krantz as he walks through sideboys during a retirement ceremony
gas turbine systems techniciancelebrities
US Navy 051117-O-XXXXX-001 A Standard Missile Three (SM-3) is launched from the vertical launch system (VLS) aboard the Pearl Harbor based Aegis cruiser USS Lake Erie (CG 70)
launches of rim-161 standard sm-3missile launches by night
US Navy 060101-N-9866B-337 The amphibious assault ship USS Peleliu (LHA 5) home ported at Naval Station San Diego displays her holiday lights in celebration during the first morning sunrise of the New Year
aboard uss peleliu (lha-5)vehicle
US Navy 051215-N-3532C-001 Crew members aboard the deep submergence vehicle USS Dolphin (AGSS 555), pulls into San Diego harbor after conducting an underway period off the coast of Southern California
waterboat
US Navy 060222-N-0780F-005 The Nimitz-class aircraft carrier USS Theodore Roosevelt (CVN 71) arrives for a logistics stop on the Greek island of Crete
vehicleboat
US Navy 060302-N-1960H-093 USS Kitty Hawk (CV 63) Commanding Officer, Capt. Ed McNamee, reads a Dr. Seuss book to a 2nd grade class at Sullivans Elementary School
reading bookdr. seuss
US Navy 031111-N-8955H-002 The 7th Fleet amphibious command and control ship USS Blue Ridge (LCC 19) rests at Victor Six pier in Guam during a recent port call
general views of uss blue ridge (lcc-19)front views of naval ships
US Navy 061121-N-2716P-002 U.S. Navy High-Speed Vessel Swift (HSV 2) maneuvers through Yokosuka Bay, as it departs Commander Fleet Activities Yokosuka, Japan following a routine port visit
waterboat
US Navy 061127-N-7656R-001 The Thanksgiving holiday weekend brought four to six inches of snow to the Pacific Northwest region
wintersnow
US Navy 070525-N-1226D-129 Marines assigned to the 13th Marine Expeditionary Unit (MEU) make their way into Kuwait Naval Base after disembarking a landing craft air cushion (LCAC) from USS Bonhomme Richard (LHD 6)
landing craftair cushion
US Navy 070319-N-0483B-001 Large harbor tugs assist Arleigh Burke-class guided missile destroyer USS John S. McCain (DDG 56) as she departs Commander Fleet Activities Yokosuka
boatship
US Navy 070320-N-5253W-001 Pierside line handlers release a forward mooring line from the bollards as the Oliver Hazard Perry-class guided missile frigate USS Gary (FFG 51) gets underway on board Commander Fleet Activities Yoko
yokosuka naval base in the 2000sboat
US Navy 070501-N-0696M-358 Master Chief Petty Officer of the Navy (MCPON) Joe R. Campa Jr. answers a Sailor's question during one of two all hands calls held at the Naval Station Norfolk base theater
naval station norfolkjr
US Navy 071002-N-6999H-004 Mineman 1st Class Ralph Bishop, left, and Electronics Technician 1st Class Verlon Cox attached to USS Freedom (LCS 1) and Clarence Good, receive the Distinguished Service Award
presentation of medalsmineman
US Navy 071107-N-4399G-026 William H. Ryzewic, U.S. Pacific Fleet deputy chief of staff for fleet maintenance, discusses ship maintenance procedures and responsibilities with Capt. David A. Lausman, commanding officer of USS Bl
aboard uss blue ridge (lcc-19)people
US Navy 070807-N-4515N-192 Navy divers from Mobile Diving and Salvage Unit (MDSU) 2 from Naval Amphibious Base Little Creek, Va., survey and assess the wreckage of the I-35 Bridge
i-35w mississippi river bridge collapse recoveryriver
US Navy 070826-N-6278K-076 Cmdr. Nita Sood, a U.S. Public Health Service pharmacist attached to the Military Sealift Command hospital ship USNS Comfort (T-AH 20), fills out a prescription
united states navy images from colombiapharmacists from the united states
US Navy 070917-N-8607R-007 Master Chief Petty Officer of the Navy (MCPON) Joe R. Campa Jr. speaks with chief petty officer selectees about their new roles as leaders during a visit to Naval Base Ventura County Point Mugu
pacific missile test center point mugujr
US Navy 070807-N-4515N-036 Navy divers from Mobile Diving and Salvage Unit (MDSU) 2 from Naval Amphibious Base Little Creek, Va., survey and assess the wreckage of the I-35 Bridge
united states navy mobile diving and salvage unit twoboat
US Navy 070810-N-3093M-003 Navy Divers from Mobile Diving and Salvage Unit (MDSU) 2 from Naval Amphibious Base Little Creek, Va., enter the water during a salvage dive in the Mississippi River
i-35w mississippi river bridge collapse recoveryunited states navy images from minneapolis
US Navy 070817-N-8534H-001 Ryoichi Kabaya, the Mayor of Yokosuka City, throws the opening pitch to Capt. Daniel Weed, commander of Fleet Activities Yokosuka, hoping to get one past Japan Maritime Self Defense Force Rear Adm. Is
yokosuka naval base in the 2000speople
US Navy 070817-N-9486C-303 Capt. Douglas Wied, commander of Task Group 40.9, and Cmdr. Charles Rock, commanding officer of High Speed Vessel (HSV) 2 Swift, along with the leadership of Naval Base Del Caribe, render honors durin
hsv-2 swift (ship2003
US Navy 070823-F-6489S-008 Storekeeper Seaman Jonathan James, from Naval Air Station Whidbey Island, Wash
militaryvehicle
US Navy 080713-N-4973M-162 Seaman Jamar Warren, assigned to Amphibious Construction Battalion (ACB) 1, unravels 600 feet of line on Red Beach during Joint Logistics Over-The-Shore (JLOTS) 2008
marine corps base camp pendletonjoint logistics over the shore
US Navy 080721-N-1424C-317 The Army Trident pier approaches Gold Beach during Joint Logistics Over-The-Shore (JLOTS) 2008
vehicleboat
US Navy 080720-N-1424C-093 he force of the ocean rushes around the bulldozer as it digs a sand ramp at Gold Beach during Joint Logistics Over-The-Shore (JLOTS) 2008
military bulldozers of the united statesjoint logistics over the shore
US Navy 040630-N-2911P-004 Ships from seven participating nations sit pier side at Pearl Harbor, Hawaii, awaiting the start of exercise Rim of the Pacific (RIMPAC) 2004
naturewater
US Navy 090203-N-1113S-001 Vice Adm. Tohru Izumi, commander-in-chief of the Japan Self-Defense Fleet is greeted by Vice Adm. John M. Bird, Commander, U.S. 7th Fleet
yokosuka naval base in the 2000saboard uss blue ridge (lcc-19)
US Navy 080816-N-9620B-002 Cmdr. Brian Alexander, an optometrist based at Portsmouth Naval Hospital, and Hospital Corpsman 3rd Class Richard Utley perform surgery aboard the amphibious assault ship USS Kearsarge (LHD 3)
united states navy images from puerto cabezasaboard uss kearsarge (lhd-3)
US Navy 081118-N-1424C-552 Seabees assigned to Amphibious Construction Battalion (ACB) 1 conduct a chemical, biological and radiological drill
peoplegroup
US Navy 081219-N-3262C-015 Capt. Thom W. Burke iscusses different aspects of the bridge with sailors from the Japan Maritime Self-Defense Force ship Tachikaze (DDG 168)
aboard uss blue ridge (lcc-19)navy
US Navy 090112-N-5253W-008 Sailors assigned to the Ticonderoga-class guided-missile cruiser USS Shiloh (CG 67), paint the ship's hull during a restricted availability maintenance period
vehiclewater
US Navy 080215-N-5387K-002 Rear Adm. James Kelly, commander of Naval Forces Japan, speaks at a naturalization ceremony during which more than 60 Yokosuka service members were sworn in as citizens of the United States
yokosuka naval base in the 2000sindoor
US Navy 071127-N-3136P-023 Aircraft carrier USS Kitty Hawk (CV 63) and Carrier Air Wing (CVW) 5 Sailors man the rails as the ship enters Truman Bay, Yokosuka
sidewalkpavement
US Navy 071128-N-0807W-032 A Sailor from the forward-deployed mine countermeasures ship USS Patriot (MCM 7) uses a telescopic alidade to determine the bearing of other ships, as it returns to its forward-deployed operating base
sunsetsun
US Navy 071205-N-3136P-030 A Carrier Airborne Early Warning Squadron (VAW) 115 E-2C Hawkeye is lowered onto the pier from the flight deck of the aircraft carrier USS Kitty Hawk (CV 63)
e-2c hawkeyemilitary
US Navy 071204-N-8933S-058 Cameroonian sailors salute Capt. John B. Nowell Jr., commodore, Africa Partnership Station (APS), on the departure from Limbe Naval Base after discussions of training and construction projects
armyjr
U.S. Navy C-21A Learjet in snow
vehiclewinter
Defense.gov News Photo 110419-N-TT977-250 - Commander of the 101st Airborne Division Maj. Gen. John F. Campbell briefs Chairman of the Joint Chiefs of Staff Adm. Mike Mullen during a visit to
defense.gov news media for april 2011michael g. mullen in 2011
200428-N-LP168-020 (49838149337)
cityscapeskyline
AD-4NA Skyraiders of VA-822 in flight over Louisiana
militaryvehicle
3rd Medical Battalion staff conducts turnover with U.S. Naval Hospital Guam 200507-M-RB959-1029 (49869977218)
uss theodore roosevelt (cvn-71) during the covid-19 pandemiccovid-19 testing in guam
3rd Medical Battalion nurses and Corpsmen conduct ICU training 200424-M-RB959-1093 (49864579442)
2020 united states navy images from naval base guammedical training
3rd Medical Battalion staff conducts turnover with U.S. Naval Hospital Guam 200507-M-RB959-1026 (49870512046)
uss theodore roosevelt (cvn-71) during the covid-19 pandemiccovid-19 testing in guam
Red yellow sea
japansea
Solidago rugosa var. aspera, high quality wet-prairie remnant southwest of Arnold Air Force Base headquarters, Coffee County, Tennessee.
springgrass
South Queensland Kauri, Agathis robusta, Auckland Domain, Auckland, New Zealand. People walking near the base of the tree provide an idea of scale.
springtree
ROCAF S-70C Flight Demonstration at Chiayi AFB 20120811c
militaryvehicle
ROCAF F-16A 6635 Flight Demonstration in Chiayi AFB 20120811b
self-published workcc-zero
ROCAF Thundertigers AT-3 0823 Parking at Ching Chuang Kang AFB Apron 20161126
aircraftaviation
ROCN Land-based Anti-ship Missiles Battalion Recurit Booth in Keelung Naval Pier Basketball Court 20150316
street scenepeople
Skyguard Radar Display at Ching Chuang Kang AFB 20161126a
radar antennaarmy
Six ROCMC Frogmen Jumping for Celebrating Open Day Mission Completed 20161112
self-published workcc-zero
Gesnes-le-Gandelin (Sarthe) église position de la tour par rapport au nef
self-published workarchitecture
Shuttle Bus Leaving Main Battalion Gate Station 20161126
vehiclecar
Thundertigers AT-3 0846 Parked at Hsinchu AFB Apron 20151121a
aircraftvehicle
Tailfins of ROCAF Beechcraft 1900C 1903 20160813
aircraftvehicle
ROCMC AAVR-7A1s Display at Navy Fleet Command Ground 20141123
self-published workvehicle
Front View of International 3.5ton 4WD Truck Loaded on ROCN Ho Chion (LCU-481) 20141123
self-published workcc-zero
Oerlikon GDF-006 35mm Twin Cannon Display at Ching Chuang Kang AFB 20161126a
militarynavy
CM-32 Yunpao APC Display in CCK Air Field 20111112b
self-published workvehicle
Two Thundertigers AT-3 Flight over Hsinchu AFB 20151121a
militaryvehicle
US Navy 060406-N-2385R-237 Deck Department personnel lower a rigid hull inflatable boat (RHIB) into the water during a man overboard drill as part of a friends and family day cruise
boatship
US Navy 060420-F-0692M-068 U.S. Air Force 2nd Lt. Sahira Sanchez assigned to the 30th Space Communications Squadron, corrects her gas mask during the Quick Shot 2006 field exercise
marine corps base camp pendletonpeople
US Navy 060602-N-4953E-002 Members of guided-missile destroyer USS Stethem (DDG 63) Flag Detail stands at attention along with Chief Petty Officers during a retirement ceremony in honor of Chief Gas Turbine Systems Technician T
yokosuka naval base in the 2000sgas turbine systems technician
US Navy 060526-N-0635C-066 Machinist's Mate 2nd Class Tempie M. Devers salutes after receiving the Bronze Star with Combat Distinguishing Device
united states navy explosive ordnance disposalnaval amphibious base little creek
US Navy 060813-F-7049H-059 Six Blue Angel F-18 Super Hornets, fly in delta formation into the rainy mists surrounding Elmendorf AFB during Arctic Thunder
aircraftmountain
US Navy 070501-N-0696M-411 Master Chief Petty Officer of the Navy (MCPON) Joe R. Campa Jr. answers a Sailor's question during one of two all hands calls held at the Naval Station Norfolk base theater
naval station norfolkjr
US Navy 070119-N-4965F-001 U.S. Coast Guard Food Service Specialist 3rd Class Lamont Brown assigned to the Honolulu based Coast Guard Cutter Jarvis (WHEC 725), has his hands taped
united states navy images from pearl harborboxing in the united states
US Navy 031012-N-3236B-003 A Landing Craft Air Cushion (LCAC) assigned to Assault Craft Unit Five (ACU-5) from Camp Pendleton, Calif., enters the well deck of the Amphibious Assault ship USS Peleliu (LHA 5)
vehicle1995
US Navy 091013-N-6692A-064 Sailors and Marines offload Marine Corps vehicles from the amphibious dock landing ship USS Tortuga (LSD 46) onto a landing craft utility
waterboat
US Navy 100114-N-5787K-004 Seabees assigned to Amphibious Construction Battalion (ACB) 2 load vehicles and equipment onto landing craft air cushion vehicles to support Operation Unified Response
air cushionarmy
US Navy 100116-N-2953W-275 Patients affected by the recent earthquake wait outside the Killick Haitian Coast Guard base clinic to receive treatment from U.S. Navy and U.S. Coast Guard medical workers
operation unified responsekillick
9901 - 10000 of 16,330 Next page
/ 164